BP915183
Clone id YMU001_000067_E04
Library
Length 303
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGGCATGCTTGCAGAGGCAGAGCTAGTGTTTCAAGAGCTTTCAACAAGAGATGAGTTTGC
ATGGATTGCTTTACTCACAGGTTATGTTGAAAATGATCATATTGAGGATGCATTAAATTT
GTTTGATTGCATGCGATGCAAGGGCATTGCATGTGGTCCTGGCATCTTCGTCTGCATTCT
CAGAGCTATTGGTAGCAAGGAAGTCATAGACAGGGGCCAGGAAATGCATGACAACATTAT
ACAAAAAGGCTTGGAAACAGATTTCATTGTGGCCAGTAGCTTGGTAGACATGTATGCCAA
ATG
■■Homology search results ■■ -
sp_hit_id O23169
Definition sp|O23169|PP353_ARATH Pentatricopeptide repeat-containing protein At4g37170 OS=Arabidopsis thaliana
Align length 102
Score (bit) 74.7
E-value 1.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915183|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_E04.
(303 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O23169|PP353_ARATH Pentatricopeptide repeat-containing protei... 75 1e-13
sp|Q9LU94|PP255_ARATH Putative pentatricopeptide repeat-containi... 73 4e-13
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 72 7e-13
sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein... 67 2e-11
sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protei... 67 2e-11
sp|Q9M1V3|PP296_ARATH Pentatricopeptide repeat-containing protei... 66 6e-11
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 65 8e-11
sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 64 2e-10
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 64 2e-10
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 63 4e-10
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 63 4e-10
sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containi... 63 4e-10
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 63 5e-10
sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containi... 62 7e-10
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 62 9e-10
sp|Q9SZK1|PP355_ARATH Pentatricopeptide repeat-containing protei... 62 9e-10
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 62 9e-10
sp|Q9LUC2|PP231_ARATH Pentatricopeptide repeat-containing protei... 62 9e-10
sp|Q9LVF9|PP245_ARATH Pentatricopeptide repeat-containing protei... 62 1e-09
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 62 1e-09
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 61 2e-09
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 61 2e-09
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 60 3e-09
sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protei... 60 3e-09
sp|O80647|PP195_ARATH Pentatricopeptide repeat-containing protei... 60 3e-09
sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protei... 60 4e-09
sp|Q9FHF9|PP419_ARATH Pentatricopeptide repeat-containing protei... 60 4e-09
sp|P0C8Q7|PP369_ARATH Pentatricopeptide repeat-containing protei... 60 4e-09
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 60 4e-09
sp|Q9FRI5|PPR57_ARATH Pentatricopeptide repeat-containing protei... 59 6e-09

>sp|O23169|PP353_ARATH Pentatricopeptide repeat-containing protein
At4g37170 OS=Arabidopsis thaliana GN=PCMP-H5 PE=2 SV=1
Length = 691

Score = 74.7 bits (182), Expect = 1e-13
Identities = 39/102 (38%), Positives = 66/102 (64%), Gaps = 2/102 (1%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFV--C 175
G+L EA +F E++ +D ++W A++TGYV+ D E+AL L+ M+ + P IF
Sbjct: 165 GLLEEARKLFDEMTEKDSYSWTAMVTGYVKKDQPEEALVLYSLMQ-RVPNSRPNIFTVSI 223

Query: 176 ILRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ A + + I RG+E+H +I++ GL++D ++ SSL+DMY K
Sbjct: 224 AVAAAAAVKCIRRGKEIHGHIVRAGLDSDEVLWSSLMDMYGK 265



Score = 41.6 bits (96), Expect = 0.001
Identities = 23/100 (23%), Positives = 46/100 (46%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + EA +F ++ +D +W +++ Y ++ + +LF + F +L
Sbjct: 267 GCIDEARNIFDKIVEKDVVSWTSMIDRYFKSSRWREGFSLFSELVGSCERPNEYTFAGVL 326

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A + G+++H + + G + +SSLVDMY K
Sbjct: 327 NACADLTTEELGKQVHGYMTRVGFDPYSFASSSLVDMYTK 366


>sp|Q9LU94|PP255_ARATH Putative pentatricopeptide repeat-containing
protein At3g25970 OS=Arabidopsis thaliana GN=PCMP-E46
PE=3 SV=2
Length = 701

Score = 73.2 bits (178), Expect = 4e-13
Identities = 38/100 (38%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A ++F E+ RD +W +++GY +EDA LF CM+ G F +L
Sbjct: 49 GFLGYANMLFDEMPKRDSVSWNTMISGYTSCGKLEDAWCLFTCMKRSGSDVDGYSFSRLL 108

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ I S + D G+++H +I+ G E + V SSLVDMYAK
Sbjct: 109 KGIASVKRFDLGEQVHGLVIKGGYECNVYVGSSLVDMYAK 148



Score = 56.2 bits (134), Expect = 5e-08
Identities = 28/100 (28%), Positives = 52/100 (52%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + +A +F+ L ++D +W +++TG+ + EDA+ F +R I F +L
Sbjct: 356 GTMEDALSLFESLKSKDLISWNSIITGFAQKGLSEDAVKFFSYLRSSEIKVDDYAFSALL 415

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
R+ + GQ++H + G ++ V SSL+ MY+K
Sbjct: 416 RSCSDLATLQLGQQIHALATKSGFVSNEFVISSLIVMYSK 455



Score = 43.1 bits (100), Expect = 4e-04
Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 1/99 (1%)
Frame = +2

Query: 2 GMLAEAELVFQELS-TRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCI 178
G +++A+ VF L ++D +W +++ G+ +++ E A LF M+ + + +
Sbjct: 252 GSVSDAKRVFDGLGGSKDLISWNSMIAGFSKHELKESAFELFIQMQRHWVETDIYTYTGL 311

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMY 295
L A +E G+ +H +I+KGLE ++L+ MY
Sbjct: 312 LSACSGEEHQIFGKSLHGMVIKKGLEQVTSATNALISMY 350



Score = 40.8 bits (94), Expect = 0.002
Identities = 21/91 (23%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
Frame = +2

Query: 29 FQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCK-GIACGPGIFVCILRAIGSKEV 205
F+E+S + +W AL+ G+V+ I+ A L M K + G F +L +
Sbjct: 159 FKEISEPNSVSWNALIAGFVQVRDIKTAFWLLGLMEMKAAVTMDAGTFAPLLTLLDDPMF 218

Query: 206 IDRGQEMHDNIIQKGLETDFIVASSLVDMYA 298
+ +++H +++ GL+ + + ++++ YA
Sbjct: 219 CNLLKQVHAKVLKLGLQHEITICNAMISSYA 249



Score = 34.7 bits (78), Expect = 0.15
Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDE-FAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCI 178
G++ A FQ++S++ AW A++ GY ++ + +L+LF M + + F I
Sbjct: 457 GIIESARKCFQQISSKHSTVAWNAMILGYAQHGLGQVSLDLFSQMCNQNVKLDHVTFTAI 516

Query: 179 LRAIGSKEVIDRGQEM 226
L A +I G E+
Sbjct: 517 LTACSHTGLIQEGLEL 532


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 72.4 bits (176), Expect = 7e-13
Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCM-RCKGIACGPGIFVCI 178
G + EAELVF E+ +D +W ++ GY +N + +AL+LF+ + K + C+
Sbjct: 446 GSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVACV 505

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
L A S D+G+E+H I++ G +D VA+SLVDMYAK
Sbjct: 506 LPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAK 546



Score = 56.6 bits (135), Expect = 4e-08
Identities = 30/100 (30%), Positives = 54/100 (54%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A+ VF+E+S R ++ +++ GY +A+ LF+ M +GI+ +L
Sbjct: 345 GDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGISPDVYTVTAVL 404

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
++D G+ +H+ I + L D V+++L+DMYAK
Sbjct: 405 NCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAK 444



Score = 48.9 bits (115), Expect = 8e-06
Identities = 26/95 (27%), Positives = 45/95 (47%)
Frame = +2

Query: 17 AELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGS 196
A VF E++ RD +W +++ GYV N E L++F M GI V +
Sbjct: 249 ARKVFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCAD 308

Query: 197 KEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+I G+ +H ++ + ++L+DMY+K
Sbjct: 309 SRLISLGRAVHSIGVKACFSREDRFCNTLLDMYSK 343



Score = 46.2 bits (108), Expect = 5e-05
Identities = 26/100 (26%), Positives = 43/100 (43%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L EA VF E+ W L+ ++ ++ LF M G+ F C+
Sbjct: 143 GDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVS 202

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
++ S + G+++H I++ G V +SLV Y K
Sbjct: 203 KSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLK 242


>sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein
At1g03540 OS=Arabidopsis thaliana GN=PCMP-E4 PE=2 SV=1
Length = 609

Score = 67.4 bits (163), Expect = 2e-11
Identities = 36/97 (37%), Positives = 56/97 (57%), Gaps = 1/97 (1%)
Frame = +2

Query: 14 EAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCM-RCKGIACGPGIFVCILRAI 190
+A VF E+ D W A+L+ + +ND E+AL LF M R KG+ F +L A
Sbjct: 216 DARRVFDEMPEPDVICWTAVLSAFSKNDLYEEALGLFYAMHRGKGLVPDGSTFGTVLTAC 275

Query: 191 GSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G+ + +G+E+H +I G+ ++ +V SSL+DMY K
Sbjct: 276 GNLRRLKQGKEIHGKLITNGIGSNVVVESSLLDMYGK 312



Score = 61.6 bits (148), Expect = 1e-09
Identities = 33/100 (33%), Positives = 54/100 (54%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + EA VF +S ++ +W ALL GY +N E A+ +F M K + C F +L
Sbjct: 314 GSVREARQVFNGMSKKNSVSWSALLGGYCQNGEHEKAIEIFREMEEKDLYC----FGTVL 369

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A + G+E+H +++G + IV S+L+D+Y K
Sbjct: 370 KACAGLAAVRLGKEIHGQYVRRGCFGNVIVESALIDLYGK 409



Score = 43.1 bits (100), Expect = 4e-04
Identities = 23/73 (31%), Positives = 39/73 (53%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + A V+ ++S R+ W A+L+ +N E+A++ F+ M KGI F+ IL
Sbjct: 411 GCIDSASRVYSKMSIRNMITWNAMLSALAQNGRGEEAVSFFNDMVKKGIKPDYISFIAIL 470

Query: 182 RAIGSKEVIDRGQ 220
A G ++D G+
Sbjct: 471 TACGHTGMVDEGR 483



Score = 36.6 bits (83), Expect = 0.040
Identities = 22/96 (22%), Positives = 41/96 (42%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
+ E VF +D +W ++++GYV AL +F M G+ ++A
Sbjct: 113 MRETRRVFDGRFVKDAISWTSMMSGYVTGKEHVKALEVFVEMVSFGLDANEFTLSSAVKA 172

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMY 295
+ G+ H +I G E + ++S+L +Y
Sbjct: 173 CSELGEVRLGRCFHGVVITHGFEWNHFISSTLAYLY 208


>sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protein
At1g31430 OS=Arabidopsis thaliana GN=PCMP-E55 PE=2 SV=1
Length = 570

Score = 67.4 bits (163), Expect = 2e-11
Identities = 32/100 (32%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + EA ++F+ +D W A++ GYV+ + ++AL LF CM+ GI + V +L
Sbjct: 227 GRIDEARVLFERSPVKDVVLWTAMMNGYVQFNRFDEALELFRCMQTAGIRPDNFVLVSLL 286

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+++G+ +H I + + D +V ++LVDMYAK
Sbjct: 287 TGCAQTGALEQGKWIHGYINENRVTVDKVVGTALVDMYAK 326



Score = 37.7 bits (86), Expect = 0.018
Identities = 23/87 (26%), Positives = 41/87 (47%)
Frame = +2

Query: 38 LSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGSKEVIDRG 217
L T + +L + L LF +R +G+ +L++IG + G
Sbjct: 6 LQTPSLLMYNKMLKSLADGKSFTKVLALFGELRGQGLYPDNFTLPVVLKSIGRLRKVIEG 65

Query: 218 QEMHDNIIQKGLETDFIVASSLVDMYA 298
+++H ++ GLE D V++SL+ MYA
Sbjct: 66 EKVHGYAVKAGLEFDSYVSNSLMGMYA 92


>sp|Q9M1V3|PP296_ARATH Pentatricopeptide repeat-containing protein
At3g63370 OS=Arabidopsis thaliana GN=PCMP-H83 PE=2 SV=2
Length = 960

Score = 65.9 bits (159), Expect = 6e-11
Identities = 35/100 (35%), Positives = 52/100 (52%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L +AE VF E+ R FAW ++ YV N AL L+ MR +G+ G F +L
Sbjct: 130 GSLDDAEKVFDEMPDRTAFAWNTMIGAYVSNGEPASALALYWNMRVEGVPLGLSSFPALL 189

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A I G E+H +++ G + + ++LV MYAK
Sbjct: 190 KACAKLRDIRSGSELHSLLVKLGYHSTGFIVNALVSMYAK 229



Score = 57.0 bits (136), Expect = 3e-08
Identities = 29/100 (29%), Positives = 53/100 (53%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + +AE + ++++ D W +L+ GYV+N ++AL F M G I+
Sbjct: 334 GKMPQAERILRQMNNADVVTWNSLIKGYVQNLMYKEALEFFSDMIAAGHKSDEVSMTSII 393

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A G + G E+H +I+ G +++ V ++L+DMY+K
Sbjct: 394 AASGRLSNLLAGMELHAYVIKHGWDSNLQVGNTLIDMYSK 433



Score = 54.3 bits (129), Expect = 2e-07
Identities = 27/94 (28%), Positives = 53/94 (56%)
Frame = +2

Query: 17 AELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGS 196
A VF+ + +D +W ++++ N + +A+ LF M G++ +CIL A S
Sbjct: 540 ATRVFESIKGKDVVSWTSMISSSALNGNESEAVELFRRMVETGLSADSVALLCILSAAAS 599

Query: 197 KEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYA 298
+++G+E+H +++KG + +A ++VDMYA
Sbjct: 600 LSALNKGREIHCYLLRKGFCLEGSIAVAVVDMYA 633



Score = 47.4 bits (111), Expect = 2e-05
Identities = 29/91 (31%), Positives = 49/91 (53%)
Frame = +2

Query: 29 FQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGSKEVI 208
F + +D +W ++ GY +ND +AL LF + K + I ILRA + +
Sbjct: 444 FLRMHDKDLISWTTVIAGYAQNDCHVEALELFRDVAKKRMEIDEMILGSILRASSVLKSM 503

Query: 209 DRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+E+H +I++KGL D ++ + LVD+Y K
Sbjct: 504 LIVKEIHCHILRKGL-LDTVIQNELVDVYGK 533


>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein
At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1
Length = 722

Score = 65.5 bits (158), Expect = 8e-11
Identities = 29/100 (29%), Positives = 59/100 (59%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L +A+++F + +D W +++ YVE+D+ ++AL +F+ M C GI ++
Sbjct: 292 GRLDDAQVIFDQTEKKDLVCWTTMISAYVESDYPQEALRVFEEMCCSGIKPDVVSMFSVI 351

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A + ++D+ + +H I GLE++ + ++L++MYAK
Sbjct: 352 SACANLGILDKAKWVHSCIHVNGLESELSINNALINMYAK 391



Score = 30.4 bits (67), Expect = 2.9
Identities = 14/67 (20%), Positives = 34/67 (50%)
Frame = +2

Query: 26 VFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGSKEV 205
VF+++ R+ +W +++ + DAL+LF M+ + + FV +L +
Sbjct: 401 VFEKMPRRNVVSWSSMINALSMHGEASDALSLFARMKQENVEPNEVTFVGVLYGCSHSGL 460

Query: 206 IDRGQEM 226
++ G+++
Sbjct: 461 VEEGKKI 467


>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein
At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=2 SV=2
Length = 823

Score = 64.3 bits (155), Expect = 2e-10
Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKG-IACGPGIFVCI 178
G++ A VF L D +W +++GY +N +A+ +++ M +G IA G +V +
Sbjct: 398 GLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIMEEEGEIAANQGTWVSV 457

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
L A + +G ++H +++ GL D V +SL DMY K
Sbjct: 458 LPACSQAGALRQGMKLHGRLLKNGLYLDVFVVTSLADMYGK 498



Score = 54.3 bits (129), Expect = 2e-07
Identities = 29/98 (29%), Positives = 55/98 (56%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
+ A ++F E+ RD +W A+++GY ++ + ++AL L + +R A V +L A
Sbjct: 201 VGNARILFDEMPVRDMGSWNAMISGYCQSGNAKEALTLSNGLR----AMDSVTVVSLLSA 256

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+RG +H I+ GLE++ V++ L+D+YA+
Sbjct: 257 CTEAGDFNRGVTIHSYSIKHGLESELFVSNKLIDLYAE 294



Score = 41.6 bits (96), Expect = 0.001
Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 1/101 (0%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDC-MRCKGIACGPGIFVCI 178
G +A A F + RD +AW +++GY + + + F M G+ F +
Sbjct: 100 GNVALARHTFDHIQNRDVYAWNLMISGYGRAGNSSEVIRCFSLFMLSSGLTPDYRTFPSV 159

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
L+A + VID G ++H ++ G D VA+SL+ +Y++
Sbjct: 160 LKA--CRTVID-GNKIHCLALKFGFMWDVYVAASLIHLYSR 197


>sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein
At5g55740, chloroplastic OS=Arabidopsis thaliana
GN=CRR21 PE=2 SV=1
Length = 830

Score = 63.9 bits (154), Expect = 2e-10
Identities = 35/100 (35%), Positives = 55/100 (55%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G+L +A VF E+ R+ AW AL+ GYV+N E+A+ LF MR +G+ L
Sbjct: 222 GVLDDASKVFDEIPDRNAVAWNALMVGYVQNGKNEEAIRLFSDMRKQGVEPTRVTVSTCL 281

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A + ++ G++ H I G+E D I+ +SL++ Y K
Sbjct: 282 SASANMGGVEEGKQSHAIAIVNGMELDNILGTSLLNFYCK 321



Score = 60.1 bits (144), Expect = 3e-09
Identities = 29/100 (29%), Positives = 55/100 (55%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G++ AE+VF + +D W +++GYV+ +EDA+ + MR + + ++
Sbjct: 323 GLIEYAEMVFDRMFEKDVVTWNLIISGYVQQGLVEDAIYMCQLMRLEKLKYDCVTLATLM 382

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A E + G+E+ I+ E+D ++AS+++DMYAK
Sbjct: 383 SAAARTENLKLGKEVQCYCIRHSFESDIVLASTVMDMYAK 422



Score = 43.1 bits (100), Expect = 4e-04
Identities = 30/95 (31%), Positives = 47/95 (49%)
Frame = +2

Query: 17 AELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGS 196
AE++F +L R+ F+W A++ E AL F M I + + +A G+
Sbjct: 126 AEVLFSKLRVRNVFSWAAIIGVKCRIGLCEGALMGFVEMLENEIFPDNFVVPNVCKACGA 185

Query: 197 KEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ G+ +H +++ GLE VASSL DMY K
Sbjct: 186 LKWSRFGRGVHGYVVKSGLEDCVFVASSLADMYGK 220



Score = 35.0 bits (79), Expect = 0.12
Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 5/105 (4%)
Frame = +2

Query: 2 GMLAEAELVFQELSTR----DEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIF 169
G + EA+ +F ++ + + +W ++ G V+N E+A+ M+ G+
Sbjct: 490 GQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEEAILFLRKMQESGLRPNAFSI 549

Query: 170 VCILRAIGSKEVIDRGQEMHDNIIQKGLETDFI-VASSLVDMYAK 301
L A + G+ +H II+ + + + +SLVDMYAK
Sbjct: 550 TVALSACAHLASLHIGRTIHGYIIRNLQHSSLVSIETSLVDMYAK 594


>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein
At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1
Length = 834

Score = 63.2 bits (152), Expect = 4e-10
Identities = 32/98 (32%), Positives = 55/98 (56%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
L ++ LVF E+ +D W ++ GYV+ E+ALNLF ++ F ++ A
Sbjct: 505 LKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEEALNLFLELQLSRERPDEFTFANMVTA 564

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G+ + GQE H ++++GLE + + ++L+DMYAK
Sbjct: 565 AGNLASVQLGQEFHCQLLKRGLECNPYITNALLDMYAK 602



Score = 53.9 bits (128), Expect = 2e-07
Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVC-- 175
G + A +F + ++ +W LL+GY +N ++A+ LF M G+ P ++ C
Sbjct: 298 GRVIAAHKLFNGMPNKNIISWTTLLSGYKQNALHKEAMELFTSMSKFGLK--PDMYACSS 355

Query: 176 ILRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
IL + S + G ++H I+ L D V +SL+DMYAK
Sbjct: 356 ILTSCASLHALGFGTQVHAYTIKANLGNDSYVTNSLIDMYAK 397



Score = 44.7 bits (104), Expect = 1e-04
Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 3/100 (3%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVEND---HIEDALNLFDCMRCKGIACGPGIFVCI 178
L +A VF + D + A++ GY + +ALN+F MR + I FV +
Sbjct: 401 LTDARKVFDIFAAADVVLFNAMIEGYSRLGTQWELHEALNIFRDMRFRLIRPSLLTFVSL 460

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYA 298
LRA S + +++H + + GL D S+L+D+Y+
Sbjct: 461 LRASASLTSLGLSKQIHGLMFKYGLNLDIFAGSALIDVYS 500



Score = 43.5 bits (101), Expect = 3e-04
Identities = 26/100 (26%), Positives = 47/100 (47%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + A LVF L + W +++G V+ +L LF + + I +L
Sbjct: 197 GNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVSLQLFYQLMEDNVVPDGYILSTVL 256

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A ++ G+++H +I++ GLE D + + L+D Y K
Sbjct: 257 SACSILPFLEGGKQIHAHILRYGLEMDASLMNVLIDSYVK 296


tr_hit_id A7PM23
Definition tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genome shotgun sequence OS=Vitis vinifera
Align length 100
Score (bit) 73.6
E-value 5.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915183|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_E04.
(303 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genom... 74 5e-12
tr|A7R3R7|A7R3R7_VITVI Chromosome undetermined scaffold_560, who... 73 8e-12
tr|A7P7N4|A7P7N4_VITVI Chromosome chr9 scaffold_7, whole genome ... 73 8e-12
tr|Q7F2F8|Q7F2F8_ORYSJ P0402A09.8 protein (P0455C04.2 protein) O... 72 1e-11
tr|Q655L5|Q655L5_ORYSJ Putative uncharacterized protein P0672D08... 72 1e-11
tr|B8ACR8|B8ACR8_ORYSI Putative uncharacterized protein OS=Oryza... 72 1e-11
tr|A7R1R7|A7R1R7_VITVI Chromosome chr4 scaffold_373, whole genom... 72 1e-11
tr|A7Q5S4|A7Q5S4_VITVI Chromosome chr14 scaffold_54, whole genom... 72 1e-11
tr|A2ZN87|A2ZN87_ORYSJ Putative uncharacterized protein OS=Oryza... 72 1e-11
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 72 1e-11
tr|A7PM57|A7PM57_VITVI Chromosome chr14 scaffold_21, whole genom... 71 3e-11
tr|A5BSN6|A5BSN6_VITVI Putative uncharacterized protein OS=Vitis... 71 3e-11
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 70 4e-11
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 70 4e-11
tr|A7R0D7|A7R0D7_VITVI Chromosome chr6 scaffold_305, whole genom... 70 4e-11
tr|A7Q3X9|A7Q3X9_VITVI Chromosome chr13 scaffold_48, whole genom... 70 4e-11
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 70 7e-11
tr|A5AWQ4|A5AWQ4_VITVI Putative uncharacterized protein OS=Vitis... 70 7e-11
tr|Q0DC25|Q0DC25_ORYSJ Os06g0493800 protein OS=Oryza sativa subs... 69 9e-11
tr|A7Q306|A7Q306_VITVI Chromosome chr12 scaffold_47, whole genom... 69 9e-11
tr|A7Q1I8|A7Q1I8_VITVI Chromosome chr7 scaffold_44, whole genome... 69 9e-11
tr|A2YD70|A2YD70_ORYSI Putative uncharacterized protein OS=Oryza... 69 9e-11
tr|A7NSK1|A7NSK1_VITVI Chromosome chr18 scaffold_1, whole genome... 68 2e-10
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 68 3e-10
tr|A5BWB7|A5BWB7_VITVI Putative uncharacterized protein OS=Vitis... 68 3e-10
tr|A7PUR6|A7PUR6_VITVI Chromosome chr4 scaffold_32, whole genome... 67 3e-10
tr|A7PA26|A7PA26_VITVI Chromosome chr14 scaffold_9, whole genome... 67 3e-10
tr|A7P4V7|A7P4V7_VITVI Chromosome chr4 scaffold_6, whole genome ... 67 3e-10
tr|A5C7D6|A5C7D6_VITVI Putative uncharacterized protein OS=Vitis... 67 3e-10
tr|A7PEW9|A7PEW9_VITVI Chromosome chr11 scaffold_13, whole genom... 67 4e-10

>tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020655001
PE=4 SV=1
Length = 614

Score = 73.6 bits (179), Expect = 5e-12
Identities = 33/100 (33%), Positives = 58/100 (58%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + A LVF +++ RD +W ++++GY N + + L FD MR G+ + +L
Sbjct: 190 GDIEAARLVFDKMAVRDLVSWTSMISGYAHNGYNSETLGFFDLMRSSGVIPNRVSILSVL 249

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A G+ + +G+ H +IQ G E D +VA++++DMY+K
Sbjct: 250 LACGNLGALRKGEWFHSYVIQTGFEFDILVATAIMDMYSK 289



Score = 51.6 bits (122), Expect = 2e-05
Identities = 26/95 (27%), Positives = 47/95 (49%)
Frame = +2

Query: 17 AELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGS 196
A +VF+++ F W ++ G+ + +L L+ M KG+ F L++
Sbjct: 94 ASIVFEDIPNPCSFLWNVMIRGFATDGRFLSSLELYSKMMEKGLKPDKFAFPFALKSCAG 153

Query: 197 KEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ RG+ +H +++ G D V ++LVDMYAK
Sbjct: 154 LSDLQRGKVIHQHLVCCGCSNDLFVDAALVDMYAK 188



Score = 40.4 bits (93), Expect = 0.044
Identities = 25/94 (26%), Positives = 46/94 (48%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A +F E + +D W A++ Y + H A++LFD M G+ F C+L
Sbjct: 291 GSLDLARCLFDETAGKDLVCWSAMIASYGIHGHGRKAIDLFDQMVKAGVRPSHVTFTCVL 350

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSL 283
A +++ G +M+ ++ + +F++A L
Sbjct: 351 SACSHSGLLEEG-KMYFQLMTE----EFVIARKL 379


>tr|A7R3R7|A7R3R7_VITVI Chromosome undetermined scaffold_560, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00003900001 PE=4 SV=1
Length = 609

Score = 72.8 bits (177), Expect = 8e-12
Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCM-RCKGIACGPGIFVCI 178
G L EA +F +++ RD F+W A+++GYV +D E+AL LF M R + C
Sbjct: 169 GRLQEARKLFDQMTERDNFSWTAMISGYVRHDRHEEALELFRAMQRHENFKCNKFTMSSA 228

Query: 179 LRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
L A + + + G+E+H +I++ GL+ D +V S+L DMY K
Sbjct: 229 LAASAAIQSLHLGKEIHGHILRIGLDLDGVVWSALSDMYGK 269


>tr|A7P7N4|A7P7N4_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034531001
PE=4 SV=1
Length = 872

Score = 72.8 bits (177), Expect = 8e-12
Identities = 38/100 (38%), Positives = 59/100 (59%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L EA VF +++ RD F+W L+ GY + + ++ALNL+ M GI F C+L
Sbjct: 143 GDLVEAWYVFGKMAERDLFSWNVLVGGYAKAGYFDEALNLYHRMLWVGIRPDVYTFPCVL 202

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
R G + RG+E+H ++I+ G E+D V ++L+ MY K
Sbjct: 203 RTCGGLPDLARGREVHLHVIRYGFESDVDVVNALITMYVK 242



Score = 62.0 bits (149), Expect = 1e-08
Identities = 32/100 (32%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G EAE+VF ++ +D +W A+++GY +N E A+ + M +G+ +L
Sbjct: 345 GCWDEAEMVFSKMEFKDLVSWTAMISGYEKNGLPEKAVETYTIMEHEGVVPDEITIASVL 404

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A ++D+G +H+ + GL + IVA+SL+DMY+K
Sbjct: 405 SACAGLGLLDKGIMLHEFADRTGLTSYVIVANSLIDMYSK 444



Score = 49.7 bits (117), Expect = 7e-05
Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 5/104 (4%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIF---- 169
G + A LVF + RD +W A+++GY END + L LF MR P +
Sbjct: 244 GDIFSARLVFDRMPRRDRISWNAMISGYFENDVCLEGLRLFFMMR--EFFVDPDLMTMTS 301

Query: 170 -VCILRAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYA 298
+ A+G + + G+E+H +I+ G + V +SL+ M++
Sbjct: 302 VISACEALGDERL---GREVHGYVIKTGFVAEVSVNNSLIQMHS 342



Score = 35.0 bits (79), Expect = 1.8
Identities = 22/92 (23%), Positives = 43/92 (46%)
Frame = +2

Query: 26 VFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRAIGSKEV 205
VF + ++ +W +++ G N +AL F M + V +L A
Sbjct: 454 VFHRIPNKNVISWTSIILGLRLNYRSFEALFFFQQM-ILSLKPNSVTLVSVLSACARIGA 512

Query: 206 IDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ G+E+H + ++ GL D + ++L+DMY +
Sbjct: 513 LSCGKEIHAHALRTGLGFDGFLPNALLDMYVR 544


>tr|Q7F2F8|Q7F2F8_ORYSJ P0402A09.8 protein (P0455C04.2 protein)
OS=Oryza sativa subsp. japonica GN=P0402A09.8 PE=4 SV=1
Length = 1122

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/100 (39%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
GML A+ F S + +W AL+TGYV+N E+AL LF MR G+ F I+
Sbjct: 386 GMLDAAKSNFSNRSEKSAISWTALITGYVQNGQHEEALQLFSDMRRAGLRPDRATFSSII 445

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A S +I G+++H +I+ G ++ S LVDMYAK
Sbjct: 446 KASSSLAMIGLGRQLHSYLIRSGYKSSVFSGSVLVDMYAK 485



Score = 43.1 bits (100), Expect = 0.007
Identities = 24/98 (24%), Positives = 48/98 (48%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
L + +F E+ RD ++ ++ Y N L LF M+ G + +L
Sbjct: 287 LDDMRRLFDEMPERDNVSYNVIIAAYAWNQCAATVLRLFREMQKLGFDRQVLPYATMLSV 346

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
GS + G+++H ++ GL ++ ++ ++L+DMY+K
Sbjct: 347 AGSLPDVHIGKQIHAQLVLLGLASEDLLGNALIDMYSK 384



Score = 34.7 bits (78), Expect = 2.4
Identities = 25/100 (25%), Positives = 41/100 (41%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A+ +F R+ W ++ + DAL+LF M +G+ +L
Sbjct: 88 GDLPAAQHLFLSSPHRNATTWTIMMRAHAAAGRTSDALSLFRAMLGEGVIPDRVTVTTVL 147

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G +H I+ GL+T V ++L+D Y K
Sbjct: 148 NLPGCTV-----PSLHPFAIKFGLDTHVFVCNTLLDAYCK 182


>tr|Q655L5|Q655L5_ORYSJ Putative uncharacterized protein P0672D08.16
OS=Oryza sativa subsp. japonica GN=P0672D08.16 PE=4 SV=1
Length = 810

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/100 (39%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
GML A+ F S + +W AL+TGYV+N E+AL LF MR G+ F I+
Sbjct: 386 GMLDAAKSNFSNRSEKSAISWTALITGYVQNGQHEEALQLFSDMRRAGLRPDRATFSSII 445

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A S +I G+++H +I+ G ++ S LVDMYAK
Sbjct: 446 KASSSLAMIGLGRQLHSYLIRSGYKSSVFSGSVLVDMYAK 485



Score = 43.1 bits (100), Expect = 0.007
Identities = 24/98 (24%), Positives = 48/98 (48%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
L + +F E+ RD ++ ++ Y N L LF M+ G + +L
Sbjct: 287 LDDMRRLFDEMPERDNVSYNVIIAAYAWNQCAATVLRLFREMQKLGFDRQVLPYATMLSV 346

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
GS + G+++H ++ GL ++ ++ ++L+DMY+K
Sbjct: 347 AGSLPDVHIGKQIHAQLVLLGLASEDLLGNALIDMYSK 384



Score = 34.7 bits (78), Expect = 2.4
Identities = 25/100 (25%), Positives = 41/100 (41%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A+ +F R+ W ++ + DAL+LF M +G+ +L
Sbjct: 88 GDLPAAQHLFLSSPHRNATTWTIMMRAHAAAGRTSDALSLFRAMLGEGVIPDRVTVTTVL 147

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G +H I+ GL+T V ++L+D Y K
Sbjct: 148 NLPGCTV-----PSLHPFAIKFGLDTHVFVCNTLLDAYCK 182


>tr|B8ACR8|B8ACR8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00012 PE=4 SV=1
Length = 810

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/100 (39%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
GML A+ F S + +W AL+TGYV+N E+AL LF MR G+ F I+
Sbjct: 386 GMLDAAKSNFSNRSEKSAISWTALITGYVQNGQHEEALQLFSDMRRAGLRPDRATFSSII 445

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A S +I G+++H +I+ G ++ S LVDMYAK
Sbjct: 446 KASSSLAMIGLGRQLHSYLIRSGYKSSVFSGSVLVDMYAK 485



Score = 43.1 bits (100), Expect = 0.007
Identities = 24/98 (24%), Positives = 48/98 (48%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
L + +F E+ RD ++ ++ Y N L LF M+ G + +L
Sbjct: 287 LDDMRRLFDEMPERDNVSYNVIIAAYAWNQCAATVLRLFREMQKLGFDRQVLPYATMLSV 346

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
GS + G+++H ++ GL ++ ++ ++L+DMY+K
Sbjct: 347 AGSLPDVHIGKQIHAQLVLLGLASEDLLGNALIDMYSK 384



Score = 34.7 bits (78), Expect = 2.4
Identities = 25/100 (25%), Positives = 41/100 (41%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A+ +F R+ W ++ + DAL+LF M +G+ +L
Sbjct: 88 GDLPAAQHLFLSSPHRNATTWTIMMRAHAAAGRTSDALSLFRAMLGEGVIPDRVTVTTVL 147

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G +H I+ GL+T V ++L+D Y K
Sbjct: 148 NLPGCTV-----PSLHPFAIKFGLDTHVFVCNTLLDAYCK 182


>tr|A7R1R7|A7R1R7_VITVI Chromosome chr4 scaffold_373, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00012364001
PE=4 SV=1
Length = 536

Score = 72.4 bits (176), Expect = 1e-11
Identities = 34/98 (34%), Positives = 56/98 (57%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
+ +A VF L RD F W ++ GY +ALN+++ MRC G+A F +L+A
Sbjct: 90 IEDARKVFDCLPDRDVFVWNTIIQGYANLGPFMEALNIYEYMRCSGVAANRYTFPFVLKA 149

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G+ + +GQ +H ++++ GL+ D V ++LV YAK
Sbjct: 150 CGAMKDGKKGQAIHGHVVKHGLDLDLFVGNALVAFYAK 187



Score = 49.7 bits (117), Expect = 7e-05
Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 4/95 (4%)
Frame = +2

Query: 26 VFQELSTRDEFAWIALLTGYVENDHIEDALNLF-DCMRCKG---IACGPGIFVCILRAIG 193
VF +S +D W ++++GY N +DAL LF + ++ +G A V IL A
Sbjct: 197 VFDMISEKDIVTWNSMISGYAINGCADDALVLFHNMLQVQGDTVYAPDSATLVAILPACA 256

Query: 194 SKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYA 298
I G +H +I+ G+E D + S L+ MYA
Sbjct: 257 QAAAIQEGLWIHSYVIKSGIELDAALGSGLIAMYA 291



Score = 45.4 bits (106), Expect = 0.001
Identities = 25/100 (25%), Positives = 49/100 (49%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G+L A VF + ++ W A++ Y + H ++AL +F + G+ IF+C+L
Sbjct: 294 GLLNSARDVFDRIDDKNIVVWNAIIRCYGMHGHADEALKMFSGLIDSGLHPDGVIFLCLL 353

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A ++ G E+ + + G+E +S+VD+ +
Sbjct: 354 SAFSHAGMVAEGMELFEKMGDYGVEKSSEHYASVVDILGR 393


>tr|A7Q5S4|A7Q5S4_VITVI Chromosome chr14 scaffold_54, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031076001
PE=4 SV=1
Length = 812

Score = 72.4 bits (176), Expect = 1e-11
Identities = 36/100 (36%), Positives = 55/100 (55%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L +A VF + R+ W A+L G +N H EDAL LF M+ +GIA FV ++
Sbjct: 387 GSLKQATFVFNRMKDRNVITWTAMLVGLAQNGHAEDALRLFAQMQEEGIAANSVTFVSLV 446

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ + RG+ +H ++ + G D + ++LVDMYAK
Sbjct: 447 HSCAHLGSLKRGRSIHGHLFRLGFAFDIVNMTALVDMYAK 486



Score = 58.5 bits (140), Expect = 2e-07
Identities = 32/100 (32%), Positives = 51/100 (51%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + EA+ VF + +D W +++ GYV+ + A LF M GI P ++
Sbjct: 186 GKIGEAQRVFDGMPNKDVVCWNSIIGGYVQAGCFDVAFQLFFEMHGSGIKPSPITMTSLI 245

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A G + G+ MH ++ GL D +V +S VDMY+K
Sbjct: 246 QACGGIGNLKLGKCMHGYVLGLGLGNDILVLTSFVDMYSK 285



Score = 41.2 bits (95), Expect = 0.026
Identities = 24/100 (24%), Positives = 52/100 (52%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + A VF ++ TR+ +W A+++G V N + ++ +LF + V +L
Sbjct: 287 GDIESARWVFYKMPTRNLVSWNAMISGCVRNGLVGESFDLFHRLVRSSGGFDLTTIVSLL 346

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+ + G+ +H I + E++ I+++++VD+Y+K
Sbjct: 347 QGCSQTASLATGKILHGCAI-RSFESNLILSTAIVDLYSK 385


>tr|A2ZN87|A2ZN87_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_000009 PE=4 SV=1
Length = 1372

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/100 (39%), Positives = 56/100 (56%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
GML A+ F S + +W AL+TGYV+N E+AL LF MR G+ F I+
Sbjct: 609 GMLDAAKSNFSNRSEKSAISWTALITGYVQNGQHEEALQLFSDMRRAGLRPDRATFSSII 668

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A S +I G+++H +I+ G ++ S LVDMYAK
Sbjct: 669 KASSSLAMIGLGRQLHSYLIRSGYKSSVFSGSVLVDMYAK 708



Score = 43.1 bits (100), Expect = 0.007
Identities = 24/98 (24%), Positives = 48/98 (48%)
Frame = +2

Query: 8 LAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCILRA 187
L + +F E+ RD ++ ++ Y N L LF M+ G + +L
Sbjct: 510 LDDMRRLFDEMPERDNVSYNVIIAAYAWNQCAATVLRLFREMQKLGFDRQVLPYATMLSV 569

Query: 188 IGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
GS + G+++H ++ GL ++ ++ ++L+DMY+K
Sbjct: 570 AGSLPDVHIGKQIHAQLVLLGLASEDLLGNALIDMYSK 607



Score = 34.7 bits (78), Expect = 2.4
Identities = 25/100 (25%), Positives = 41/100 (41%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L A+ +F R+ W ++ + DAL+LF M +G+ +L
Sbjct: 327 GDLPAAQHLFLSSPHRNATTWTIMMRAHAAAGRTSDALSLFRAMLGEGVIPDRVTVTTVL 386

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
G +H I+ GL+T V ++L+D Y K
Sbjct: 387 NLPGCTV-----PSLHPFAIKFGLDTHVFVCNTLLDAYCK 421


>tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169414 PE=4 SV=1
Length = 703

Score = 72.0 bits (175), Expect = 1e-11
Identities = 39/100 (39%), Positives = 57/100 (57%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G L EA VF L + +W A++ GYVE+ H EDA+ LF M +G+ G ++ IL
Sbjct: 77 GRLQEARCVFDALVKKSGASWNAMIAGYVEHKHAEDAMRLFREMCHEGVQPNAGTYMIIL 136

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
+A S + G+E+H I GLE+D V ++L+ MY K
Sbjct: 137 KACASLSALKWGKEVHACIRHGGLESDVRVGTALLRMYGK 176



Score = 55.8 bits (133), Expect = 1e-06
Identities = 29/100 (29%), Positives = 54/100 (54%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + +A +VF + RD +W ++ + E+ +A +LF M+ +G +F+ IL
Sbjct: 279 GSIDDARVVFDRMKVRDVVSWNVMIGAFAEHGRGHEAYDLFLQMQTEGCKPDAIMFLSIL 338

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A S ++ +++H + + GLE D V ++LV MY+K
Sbjct: 339 NACASAGALEWVKKIHRHALDSGLEVDVRVGTALVHMYSK 378



Score = 52.0 bits (123), Expect = 1e-05
Identities = 29/100 (29%), Positives = 49/100 (49%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + EA +F L D +W ++ Y ++ + ++A L M +G +V IL
Sbjct: 178 GSINEARRIFDNLMNHDIISWTVMIGAYAQSGNGKEAYRLMLQMEQEGFKPNAITYVSIL 237

Query: 182 RAIGSKEVIDRGQEMHDNIIQKGLETDFIVASSLVDMYAK 301
A S+ + + +H + + GLE D V ++LV MYAK
Sbjct: 238 NACASEGALKWVKRVHRHALDAGLELDVRVGTALVQMYAK 277



Score = 47.0 bits (110), Expect = 5e-04
Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
Frame = +2

Query: 2 GMLAEAELVFQELSTRDEFAWIALLTGYVENDHIEDALNLFDCMRCKGIACGPGIFVCIL 181
G + +A +VF + R+ +W A+++G ++ +DAL +F M G+ FV +L
Sbjct: 380 GSIDDARVVFDRMKVRNVVSWNAMISGLAQHGLGQDALEVFRRMTAHGVKPDRVTFVAVL 439

Query: 182 RAIGSKEVIDRGQEMHDNIIQ-KGLETDFIVASSLVDMYAK 301
A ++D G+ + + Q G+E D + +VD+ +
Sbjct: 440 SACSHAGLVDEGRSQYLAMTQVYGIEPDVSHCNCMVDLLGR 480