BP915194
Clone id YMU001_000067_F05
Library
Length 378
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_F05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCATACTTCTGTGAGTAACTTAGTGCAACATGGAAAATTCCCTTGAATTCAATTAAGTCA
TTAGTAACAACTGGTTTATTCTGGCTGTTTTCTCATTGAATTTGAAAAAACAAAACTTTT
TCTTTTTCTTTTCATTGTCTAGATTATTTTTACCCATATTATTTAGAGGTCGAGCATGAT
AAACTCAATGTTGTGGTATTTTCTGAACCTCACCATAATTATCTGAAACATCCCTATAGG
GATGAAATAAATAAACACTGTCTTCTTTAATTCCTGAGAGGTTGGGTCTTCCCCGACCCA
ATGCGAAACAAAATCTACAGCTGTACCAATAGGGTTATGTCCAAGCACTCGAAGCTAAGC
TCCGCGGCCAGGTAGCCG
■■Homology search results ■■ -
sp_hit_id Q2VF19
Definition sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria parasitica
Align length 34
Score (bit) 33.1
E-value 0.44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915194|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_F05.
(378 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria paras... 33 0.44
sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum... 32 0.74
sp|P27572|NU4M_WHEAT NADH-ubiquinone oxidoreductase chain 4 OS=T... 31 1.7
sp|P26848|NU4M_MARPO NADH-ubiquinone oxidoreductase chain 4 OS=M... 31 1.7
sp|Q04050|NU4M_BRACM NADH-ubiquinone oxidoreductase chain 4 OS=B... 31 1.7
sp|P93313|NU4M_ARATH NADH-ubiquinone oxidoreductase chain 4 OS=A... 31 1.7
sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa G... 29 6.3
sp|A1DE13|DCL1_NEOFI Dicer-like protein 1 OS=Neosartorya fischer... 29 6.3
sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae ... 29 6.3
sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase OS=Rhodopseu... 29 8.2
sp|Q4WVE3|DCL1_ASPFU Dicer-like protein 1 OS=Aspergillus fumigat... 29 8.2

>sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria
parasitica GN=DCL-1 PE=3 SV=1
Length = 1548

Score = 33.1 bits (74), Expect = 0.44
Identities = 14/34 (41%), Positives = 19/34 (55%)
Frame = +1

Query: 136 CLDYFYPYYLEVEHDKLNVVVFSEPHHNYLKHPY 237
CL Y Y + D++N++VF E HH HPY
Sbjct: 215 CLQYAY-----IRIDQINLLVFDEAHHTKKNHPY 243


>sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum
GN=DCL1 PE=3 SV=2
Length = 1607

Score = 32.3 bits (72), Expect = 0.74
Identities = 14/41 (34%), Positives = 21/41 (51%)
Frame = +1

Query: 115 TFSFSFHCLDYFYPYYLEVEHDKLNVVVFSEPHHNYLKHPY 237
T + CL + Y + D++N++VF E HH HPY
Sbjct: 243 TAEILYQCLTHSY-----IRMDQVNLLVFDEAHHTKKNHPY 278


>sp|P27572|NU4M_WHEAT NADH-ubiquinone oxidoreductase chain 4
OS=Triticum aestivum GN=ND4 PE=2 SV=2
Length = 495

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = +2

Query: 2 HTSVSNLVQHGKF 40
HTSVSNLVQHGKF
Sbjct: 482 HTSVSNLVQHGKF 494


>sp|P26848|NU4M_MARPO NADH-ubiquinone oxidoreductase chain 4
OS=Marchantia polymorpha GN=ND4 PE=3 SV=2
Length = 495

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = +2

Query: 2 HTSVSNLVQHGKF 40
HTSVSNLVQHGKF
Sbjct: 482 HTSVSNLVQHGKF 494


>sp|Q04050|NU4M_BRACM NADH-ubiquinone oxidoreductase chain 4
OS=Brassica campestris GN=ND4 PE=3 SV=1
Length = 495

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = +2

Query: 2 HTSVSNLVQHGKF 40
HTSVSNLVQHGKF
Sbjct: 482 HTSVSNLVQHGKF 494


>sp|P93313|NU4M_ARATH NADH-ubiquinone oxidoreductase chain 4
OS=Arabidopsis thaliana GN=ND4 PE=2 SV=2
Length = 495

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = +2

Query: 2 HTSVSNLVQHGKF 40
HTSVSNLVQHGKF
Sbjct: 482 HTSVSNLVQHGKF 494


>sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa
GN=dcl-1 PE=2 SV=1
Length = 1584

Score = 29.3 bits (64), Expect = 6.3
Identities = 9/23 (39%), Positives = 15/23 (65%)
Frame = +1

Query: 169 VEHDKLNVVVFSEPHHNYLKHPY 237
+ D++N+++F E HH HPY
Sbjct: 244 IRMDQINLLIFDEAHHTKKDHPY 266


>sp|A1DE13|DCL1_NEOFI Dicer-like protein 1 OS=Neosartorya fischeri
(strain ATCC 1020 / DSM 3700 / NRRL 181) GN=dcl1 PE=3
SV=1
Length = 1538

Score = 29.3 bits (64), Expect = 6.3
Identities = 10/23 (43%), Positives = 16/23 (69%)
Frame = +1

Query: 169 VEHDKLNVVVFSEPHHNYLKHPY 237
V+ D++N+++F E HH HPY
Sbjct: 249 VKMDQINLLIFDEAHHAKKDHPY 271


>sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae
GN=dcl1 PE=3 SV=2
Length = 1523

Score = 29.3 bits (64), Expect = 6.3
Identities = 9/23 (39%), Positives = 15/23 (65%)
Frame = +1

Query: 169 VEHDKLNVVVFSEPHHNYLKHPY 237
+ D++N+++F E HH HPY
Sbjct: 238 IRMDQINLLIFDEAHHTKKDHPY 260


>sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase
OS=Rhodopseudomonas palustris (strain HaA2) GN=metX PE=3
SV=1
Length = 400

Score = 28.9 bits (63), Expect = 8.2
Identities = 12/40 (30%), Positives = 17/40 (42%)
Frame = +1

Query: 211 HHNYLKHPYRDEINKHCLL*FLRGWVFPDPMRNKIYSCTN 330
HH L +R + C++ F W+FP P I N
Sbjct: 312 HHGVLAAAFRGTQTRFCVVSFTSDWLFPTPESRAIVHALN 351


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915194|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_F05.
(378 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******