BP915198
Clone id YMU001_000067_F09
Library
Length 478
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000067_F09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACCAAATGACTTTCTATTTGGAAACTCATTGTGAAGGTGAGCTAACATATGTTTAAATG
ACAAATTGGCTTCGTCAGCCCTAATGGGGGCCACAGACTATAGGATTTATCTTGTCTTTT
GAGTCCTCAAAGCTGCAAACAATGGCAAAGTTCAAACATTCACTACGGCTGTCTAGTAAA
AAATACCTTGCTGCAGACGACTATAATACAGAATGTAAAATTACAAAACTGTTACAGGTT
GCTCCACACCCTAAAGAGGGAGGGCAATATGCGACATGATTGGCAAAGGGGAATGGGTGT
AAAGCAGAATTTCGACCACGCACTCTTGCTATATTTGGAGGCAGATCAGAGGCCTTCGGG
CATTCATACCGCAAAGAATGACTCCTCACAGGAAACGAGTTGACAGCTGAGACAGTGCAG
GAACAAAGGCATTACAAGCAGAGCTGCAATGCCCTCCGACGACTCTCGCCGTCCATGA
■■Homology search results ■■ -
sp_hit_id Q09764
Definition sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizosaccharomyces pombe
Align length 25
Score (bit) 30.8
E-value 3.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915198|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_F09.
(478 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizo... 31 3.3
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier prot... 30 5.6
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier prot... 30 5.6
sp|Q5WB34|SYR_BACSK Arginyl-tRNA synthetase OS=Bacillus clausii ... 30 7.4
sp|Q8VE73|CUL7_MOUSE Cullin-7 OS=Mus musculus GN=Cul7 PE=1 SV=2 29 9.4
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthes... 29 9.6
sp|Q8C0P0|MASTL_MOUSE Microtubule-associated serine/threonine-pr... 29 9.6

>sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c
OS=Schizosaccharomyces pombe GN=SPAC24H6.11c PE=2 SV=1
Length = 958

Score = 30.8 bits (68), Expect = 3.3
Identities = 12/25 (48%), Positives = 17/25 (68%)
Frame = -2

Query: 99 SLWPPLGLTKPICHLNIC*LTFTMS 25
SLW P+G+T I + IC + FTM+
Sbjct: 539 SLWDPIGITTKIEYFTICAIVFTMT 563


>sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein
SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=2 SV=1
Length = 467

Score = 30.0 bits (66), Expect = 5.6
Identities = 15/43 (34%), Positives = 23/43 (53%)
Frame = +2

Query: 212 NVKLQNCYRLLHTLKREGNMRHDWQRGMGVKQNFDHALLLYLE 340
++ L+ ++LH++ R+G M DWQ DH LL LE
Sbjct: 111 SISLEQAEKILHSMDRDGTMTIDWQEWR------DHFLLHSLE 147


>sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein
SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2
Length = 468

Score = 30.0 bits (66), Expect = 5.6
Identities = 15/43 (34%), Positives = 23/43 (53%)
Frame = +2

Query: 212 NVKLQNCYRLLHTLKREGNMRHDWQRGMGVKQNFDHALLLYLE 340
++ L+ ++LH++ R+G M DWQ DH LL LE
Sbjct: 112 SISLEQAEKILHSMDRDGTMTIDWQEWR------DHFLLHSLE 148


>sp|Q5WB34|SYR_BACSK Arginyl-tRNA synthetase OS=Bacillus clausii
(strain KSM-K16) GN=argS PE=3 SV=1
Length = 556

Score = 29.6 bits (65), Expect = 7.4
Identities = 18/63 (28%), Positives = 31/63 (49%)
Frame = +1

Query: 142 MAKFKHSLRLSSKKYLAADDYNTECKITKLLQVAPHPKEGGQYAT*LAKGNGCKAEFRPR 321
M + K LR+ ++ + + TE ++ +L AP K G +AT +A A+ PR
Sbjct: 4 MERKKEQLRVEVRRAVLQAELATESEVPSVLLEAPKDKAHGDFATNIAMQLARIAKKAPR 63

Query: 322 TLA 330
+A
Sbjct: 64 AIA 66


>sp|Q8VE73|CUL7_MOUSE Cullin-7 OS=Mus musculus GN=Cul7 PE=1 SV=2
Length = 1689

Score = 29.3 bits (64), Expect = 9.4
Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 5/63 (7%)
Frame = -3

Query: 257 SLGCGATCNS----FVILHSVL*SSAARYFLLDSRSECLNFAI-VCSFEDSKDKINPIVC 93
SLG GATC S ILH ++ + R+ D R + L +A+ V E + +NP
Sbjct: 1600 SLGRGATCRSSDVLSCILHLLVKGTLRRH---DDRPQVLYYAVPVTVMEPHMESLNPGSA 1656

Query: 92 GPH 84
GP+
Sbjct: 1657 GPN 1659


>sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis
class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3
Length = 435

Score = 29.3 bits (64), Expect = 9.6
Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
Frame = -2

Query: 303 FTPIPLCQSCRILPSLFRVWSNL*QFCNFTF---CIIVVCSKVF 181
F P + + F VWS+L +F F CII+VCS +F
Sbjct: 326 FKSYPTVGDVALYMAFFPVWSHLYRFLRNIFVLTCIIIVCSLLF 369


>sp|Q8C0P0|MASTL_MOUSE Microtubule-associated
serine/threonine-protein kinase-like OS=Mus musculus
GN=Mastl PE=2 SV=1
Length = 865

Score = 29.3 bits (64), Expect = 9.6
Identities = 11/37 (29%), Positives = 21/37 (56%)
Frame = +2

Query: 122 SPQSCKQWQSSNIHYGCLVKNTLLQTTIIQNVKLQNC 232
S ++C +++++ GC + TT +QN+KL C
Sbjct: 450 SKKNCTEYEANKERQGCRANQSTGLTTEVQNLKLSGC 486


tr_hit_id B3QT01
Definition tr|B3QT01|B3QT01_CHLT3 Ferrous iron transport protein B OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Align length 110
Score (bit) 33.1
E-value 7.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915198|Adiantum capillus-veneris mRNA, clone:
YMU001_000067_F09.
(478 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3QT01|B3QT01_CHLT3 Ferrous iron transport protein B OS=Chlor... 33 7.0
tr|Q12MR1|Q12MR1_SHEDO Putative uncharacterized protein OS=Shewa... 33 9.2

>tr|B3QT01|B3QT01_CHLT3 Ferrous iron transport protein B
OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
GN=Ctha_0173 PE=4 SV=1
Length = 831

Score = 33.1 bits (74), Expect = 7.0
Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 18/110 (16%)
Frame = +2

Query: 173 LVKNTLLQTTIIQ-NVKLQNCYRLLHTLKREGNMRHDWQ---------------RGMGVK 304
L +N L T +I ++K+ + L +G+ H Q +G G+K
Sbjct: 196 LERNLYLTTQLIDMDIKVVMALNMYDELTTKGDTLHIEQLGELLGIPIVPTIASKGKGIK 255

Query: 305 QNFDHALLLYLEADQRPSGIHTAKNDSSQETS*QLRQC--RNKGITSRAA 448
Q FDH + ++ E + IH D +++ L++ +NK IT +A+
Sbjct: 256 QLFDHVIQIHEETEPTYRHIHIQYGDDIEKSLHSLQELIWKNKHITDKAS 305


>tr|Q12MR1|Q12MR1_SHEDO Putative uncharacterized protein
OS=Shewanella denitrificans (strain OS217 / ATCC
BAA-1090 / DSM 15013) GN=Sden_1982 PE=4 SV=1
Length = 384

Score = 32.7 bits (73), Expect = 9.2
Identities = 27/101 (26%), Positives = 43/101 (42%)
Frame = +2

Query: 161 HYGCLVKNTLLQTTIIQNVKLQNCYRLLHTLKREGNMRHDWQRGMGVKQNFDHALLLYLE 340
H C+V N L + I + Q RHD + G K++ H L LE
Sbjct: 171 HLPCVVHNWLGERRIALEIFSQ-------APANNDEPRHDASQN-GTKKHAIHWPELVLE 222

Query: 341 ADQRPSGIHTAKNDSSQETS*QLRQCRNKGITSRAAMPSDD 463
+ + H+AK S +++S N +T+ A +PS+D
Sbjct: 223 EQRTHTAAHSAKASSCKDSSFASSAFTNNALTNSAFLPSED 263