BP915279
Clone id YMU001_000069_F06
Library
Length 505
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000069_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGCTCTCAAAGTAGGATTGAGCCTCATTCACTAATCCTAATCGACGGCAAGCATTCAGC
ACAATCACATATGTGACCAAGTTTGGTTTTACATTTTCACTCACCATTCTGTTGAACGAG
CCGAAGATGTGATCGTGCCTTCCCTCTTCTGCGTACCCTGCAATAAGAGCAGTCCACGAT
ACTACATTTCTTGCGGGAAGCACATCGAAGACTTTTTGTGCCTTTGCAAGTGCTCCACAT
TTTATGTACATGTCCACCAATGCAGTGCCAACGACACTATTTTTTCCTAGCAGCTCCCTT
CTCATGATTTCACCGTGTAATTCTTCACCCCTCTCTATGGCTATGGTGCTGCCGCACGCC
TTCAAGGCACAAGCAAAGGTCACTGCAGTAGGGGAGAGGCCCTCATGTTGCATTCTGTCA
AGACAATCCAGCGCTCTCTCGCCCTGCCCATGTTGTAAATATCCTGCAATTAAACCATTC
CAGCAAATTTCACTTCGAAATGGAA
■■Homology search results ■■ -
sp_hit_id Q9LW63
Definition sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana
Align length 165
Score (bit) 131.0
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915279|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_F06.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 131 2e-30
sp|O23491|PP315_ARATH Pentatricopeptide repeat-containing protei... 124 2e-28
sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein... 123 4e-28
sp|Q9M4P3|PP316_ARATH Pentatricopeptide repeat-containing protei... 123 6e-28
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 123 6e-28
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 122 7e-28
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 122 7e-28
sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containi... 121 2e-27
sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protei... 120 4e-27
sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protei... 119 8e-27
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 119 8e-27
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 119 8e-27
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 118 1e-26
sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containi... 118 2e-26
sp|Q9LIE7|PP246_ARATH Pentatricopeptide repeat-containing protei... 117 2e-26
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 117 3e-26
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 117 3e-26
sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protei... 117 4e-26
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 116 5e-26
sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protei... 116 7e-26
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 116 7e-26
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 115 9e-26
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 115 1e-25
sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containi... 115 1e-25
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 113 4e-25
sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protei... 112 7e-25
sp|Q9SKQ4|PP167_ARATH Pentatricopeptide repeat-containing protei... 112 1e-24
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 112 1e-24

>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing
protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32
PE=3 SV=1
Length = 715

Score = 131 bits (329), Expect = 2e-30
Identities = 68/165 (41%), Positives = 94/165 (56%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R I WN L+AGY+Q+G+ AL +M + P AV F+ + AC + G++L
Sbjct: 306 RDGISWNSLVAGYVQNGRYNEALRLFRQMVTAKVKPGAVAFSSVIPACAHLATLHLGKQL 365

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG ++R G N + +ALVDMY KCG + A+K+FD + + VSWTA+I G+A G
Sbjct: 366 HGYVLRGGF-GSNIFIASALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGH 424

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
F M + VKPN V +V VL AC +GLV+EA YF S
Sbjct: 425 GHEAVSLFEEMKRQGVKPNQVAFVAVLTACSHVGLVDEAWGYFNS 469



Score = 100 bits (249), Expect = 4e-21
Identities = 51/159 (32%), Positives = 88/159 (55%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P + + +N +IAGY Q G E AL + M L P + T + L + + +G+
Sbjct: 203 PRKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFTLSSVLPIFSEYVDVIKGK 262

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
E+HG ++R+ + + +G++LVDMY K + +++VF L R+ +SW +L+AGY +
Sbjct: 263 EIHGYVIRKGI-DSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAGYVQN 321

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVN 27
GR++ F +MV+ VKP V + V+ AC L ++
Sbjct: 322 GRYNEALRLFRQMVTAKVKPGAVAFSSVIPACAHLATLH 360



Score = 56.2 bits (134), Expect = 8e-08
Identities = 44/182 (24%), Positives = 73/182 (40%), Gaps = 38/182 (20%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ W +I + +AL M+ G P F LK+C + + GE +HG
Sbjct: 71 LAWKSVIRCFTDQSLFSKALASFVEMRASGRCPDHNVFPSVLKSCTMMMDLRFGESVHGF 130

Query: 308 IMRRELLGKNS--VVGTALVDMYIKCGALA------------------------------ 225
I+R LG + G AL++MY K +
Sbjct: 131 IVR---LGMDCDLYTGNALMNMYAKLLGMGSKISVGNVFDEMPQRTSNSGDEDVKAETCI 187

Query: 224 ------KAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVI 63
++VF+V+P ++VVS+ +IAGYA+ G ++ M + ++KP+ T
Sbjct: 188 MPFGIDSVRRVFEVMPRKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFTLSS 247

Query: 62 VL 57
VL
Sbjct: 248 VL 249


>sp|O23491|PP315_ARATH Pentatricopeptide repeat-containing protein
At4g16470 OS=Arabidopsis thaliana GN=PCMP-E12 PE=2 SV=2
Length = 501

Score = 124 bits (311), Expect = 2e-28
Identities = 61/165 (36%), Positives = 94/165 (56%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R I WN +I+GY+Q G + L M+ + P TFA +AC + +E G+
Sbjct: 172 RDLIPWNAMISGYVQKGLEQEGLFIYYDMRQNRIVPDQYTFASVFRACSALDRLEHGKRA 231

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
H +++R + N +V +ALVDMY KC + + +VFD L RNV++WT+LI+GY G+
Sbjct: 232 HAVMIKR-CIKSNIIVDSALVDMYFKCSSFSDGHRVFDQLSTRNVITWTSLISGYGYHGK 290

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
+ F +M E +PN VT+++VL AC GLV++ +F S
Sbjct: 291 VSEVLKCFEKMKEEGCRPNPVTFLVVLTACNHGGLVDKGWEHFYS 335



Score = 48.5 bits (114), Expect = 2e-05
Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 2/135 (1%)
Frame = -3

Query: 437 RALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLG--KNSVVGT 264
R + + + GL T+A L+ C +G+ +H ++ ++G N +
Sbjct: 91 RLKEAVGLLWSSGLQVEPETYAVLLQECKQRKEYTKGKRIHAQMF---VVGFALNEYLKV 147

Query: 263 ALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKP 84
L+ +Y G L A +F L R+++ W A+I+GY ++G + M + P
Sbjct: 148 KLLILYALSGDLQTAGILFRSLKIRDLIPWNAMISGYVQKGLEQEGLFIYYDMRQNRIVP 207

Query: 83 NLVTYVIVLNACRRL 39
+ T+ V AC L
Sbjct: 208 DQYTFASVFRACSAL 222


>sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein
At1g03540 OS=Arabidopsis thaliana GN=PCMP-E4 PE=2 SV=1
Length = 609

Score = 123 bits (309), Expect = 4e-28
Identities = 54/163 (33%), Positives = 99/163 (60%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++ + W+ L+ GY Q+G+ E+A++ M+ + L F LKAC A+ G+E+
Sbjct: 329 KNSVSWSALLGGYCQNGEHEKAIEIFREMEEKDL----YCFGTVLKACAGLAAVRLGKEI 384

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG+ +RR G N +V +AL+D+Y K G + A +V+ + RN+++W A+++ A+ GR
Sbjct: 385 HGQYVRRGCFG-NVIVESALIDLYGKSGCIDSASRVYSKMSIRNMITWNAMLSALAQNGR 443

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYF 9
+ FN MV + +KP+ ++++ +L AC G+V+E ++YF
Sbjct: 444 GEEAVSFFNDMVKKGIKPDYISFIAILTACGHTGMVDEGRNYF 486



Score = 99.0 bits (245), Expect = 1e-20
Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 1/154 (0%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQH-EGLSPTAVTFACALKACGSTIAIERGEELHG 312
ICW +++ + ++ E AL M +GL P TF L ACG+ +++G+E+HG
Sbjct: 230 ICWTAVLSAFSKNDLYEEALGLFYAMHRGKGLVPDGSTFGTVLTACGNLRRLKQGKEIHG 289

Query: 311 EIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHD 132
+++ + G N VV ++L+DMY KCG++ +A++VF+ + +N VSW+AL+ GY + G H+
Sbjct: 290 KLITNGI-GSNVVVESSLLDMYGKCGSVREARQVFNGMSKKNSVSWSALLGGYCQNGEHE 348

Query: 131 HIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLV 30
F M + +L + VL AC L V
Sbjct: 349 KAIEIFREMEEK----DLYCFGTVLKACAGLAAV 378



Score = 63.2 bits (152), Expect = 7e-10
Identities = 39/154 (25%), Positives = 72/154 (46%), Gaps = 1/154 (0%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
+ I W +++GY+ + +AL+ M GL T + A+KAC + G
Sbjct: 126 KDAISWTSMMSGYVTGKEHVKALEVFVEMVSFGLDANEFTLSSAVKACSELGEVRLGRCF 185

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG ++ N + + L +Y A++VFD +P +V+ WTA+++ +++
Sbjct: 186 HGVVITHG-FEWNHFISSTLAYLYGVNREPVDARRVFDEMPEPDVICWTAVLSAFSKNDL 244

Query: 137 HDHIFGSFNRM-VSENVKPNLVTYVIVLNACRRL 39
++ G F M + + P+ T+ VL AC L
Sbjct: 245 YEEALGLFYAMHRGKGLVPDGSTFGTVLTACGNL 278



Score = 58.9 bits (141), Expect = 1e-08
Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
Frame = -3

Query: 449 GQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVV 270
GQ A+ L+ + T +A L+ C + G + H +++ L +V
Sbjct: 40 GQLTEAIRILNSTHSSEIPATPKLYASLLQTCNKVFSFIHGIQFHAHVVKSGLETDRNV- 98

Query: 269 GTALVDMYIKCG-ALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSEN 93
G +L+ +Y K G + + ++VFD ++ +SWT++++GY H F MVS
Sbjct: 99 GNSLLSLYFKLGPGMRETRRVFDGRFVKDAISWTSMMSGYVTGKEHVKALEVFVEMVSFG 158

Query: 92 VKPNLVTYVIVLNACRRLGLV 30
+ N T + AC LG V
Sbjct: 159 LDANEFTLSSAVKACSELGEV 179


>sp|Q9M4P3|PP316_ARATH Pentatricopeptide repeat-containing protein
At4g16835, mitochondrial OS=Arabidopsis thaliana
GN=DYW10 PE=2 SV=2
Length = 661

Score = 123 bits (308), Expect = 6e-28
Identities = 58/162 (35%), Positives = 94/162 (58%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN +I+GY+++ + E L M EG+ P + + AL C A++ G ++H +
Sbjct: 250 VTWNAMISGYVENSRPEDGLKLFRAMLEEGIRPNSSGLSSALLGCSELSALQLGRQIH-Q 308

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
I+ + L + T+L+ MY KCG L A K+F+V+ ++VV+W A+I+GYA+ G D
Sbjct: 309 IVSKSTLCNDVTALTSLISMYCKCGELGDAWKLFEVMKKKDVVAWNAMISGYAQHGNADK 368

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
F M+ ++P+ +T+V VL AC GLVN +YFES
Sbjct: 369 ALCLFREMIDNKIRPDWITFVAVLLACNHAGLVNIGMAYFES 410



Score = 59.3 bits (142), Expect = 1e-08
Identities = 42/138 (30%), Positives = 66/138 (47%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
+N +++ Y+++ E+A DRM + A ++ + +E+ EL +M
Sbjct: 127 YNIMLSCYVRNVNFEKAQSFFDRMPFKD----AASWNTMITGYARRGEMEKARELFYSMM 182

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
KN V A++ YI+CG L KA F V P R VV+WTA+I GY + + +
Sbjct: 183 E-----KNEVSWNAMISGYIECGDLEKASHFFKVAPVRGVVAWTAMITGYMKAKKVELAE 237

Query: 122 GSFNRMVSENVKPNLVTY 69
F M V NLVT+
Sbjct: 238 AMFKDM---TVNKNLVTW 252



Score = 57.0 bits (136), Expect = 5e-08
Identities = 40/156 (25%), Positives = 69/156 (44%), Gaps = 1/156 (0%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
PF+ WN +I GY + G+ E+A + M + V++ + IE G+
Sbjct: 151 PFKDAASWNTMITGYARRGEMEKARELFYSMMEKN----EVSWNAMISGY-----IECGD 201

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVF-DVLPARNVVSWTALIAGYAE 147
+ + V TA++ Y+K + A+ +F D+ +N+V+W A+I+GY E
Sbjct: 202 LEKASHFFKVAPVRGVVAWTAMITGYMKAKKVELAEAMFKDMTVNKNLVTWNAMISGYVE 261

Query: 146 EGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL 39
R + F M+ E ++PN L C L
Sbjct: 262 NSRPEDGLKLFRAMLEEGIRPNSSGLSSALLGCSEL 297



Score = 35.4 bits (80), Expect = 0.15
Identities = 27/133 (20%), Positives = 63/133 (47%), Gaps = 1/133 (0%)
Frame = -3

Query: 401 GLSPTAVTFACALKACGSTI-AIERGEELHGEIMRRELLGKNSVVGTALVDMYIKCGALA 225
G T + +C+ +C S ++ R + L + ++ N ++ ++ G +
Sbjct: 24 GNPDTILVESCSSSSCSSPEPSLVRSDYLTKPSDQDQIFPLNKIIARC-----VRSGDID 78

Query: 224 KAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACR 45
A +VF + A+N ++W +L+ G +++ +++ E +P+ +Y I+L+
Sbjct: 79 GALRVFHGMRAKNTITWNSLLIGISKDPSR---MMEAHQLFDEIPEPDTFSYNIMLSCYV 135

Query: 44 RLGLVNEAQSYFE 6
R +AQS+F+
Sbjct: 136 RNVNFEKAQSFFD 148


>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein
At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2
Length = 1064

Score = 123 bits (308), Expect = 6e-28
Identities = 63/162 (38%), Positives = 95/162 (58%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
I WN L++G+ Q G E AL RM EG+ TF A+KA T +++G+++H
Sbjct: 658 IAWNALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQVHAV 717

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
I + + V AL+ MY KCG+++ A+K F + +N VSW A+I Y++ G
Sbjct: 718 ITKTGYDSETEVCN-ALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGFGSE 776

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
SF++M+ NV+PN VT V VL+AC +GLV++ +YFES
Sbjct: 777 ALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFES 818



Score = 87.0 bits (214), Expect = 4e-17
Identities = 50/154 (32%), Positives = 74/154 (48%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + +N LI G Q G GE+A++ RM +GL P + T A + AC + + RG++L
Sbjct: 352 RDAVTYNTLINGLSQCGYGEKAMELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQQL 411

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
H + N + G AL+++Y KC + A F NVV W ++ Y
Sbjct: 412 HAYTTKLGFASNNKIEG-ALLNLYAKCADIETALDYFLETEVENVVLWNVMLVAYGLLDD 470

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLG 36
+ F F +M E + PN TY +L C RLG
Sbjct: 471 LRNSFRIFRQMQIEEIVPNQYTYPSILKTCIRLG 504



Score = 78.6 bits (192), Expect = 2e-14
Identities = 46/127 (36%), Positives = 67/127 (52%), Gaps = 1/127 (0%)
Frame = -3

Query: 422 LDRMQHEGLSPTAVTFACALKACGSTI-AIERGEELHGEIMRRELLGKNSVVGTALVDMY 246
+D +++ G+ P T L+ C T +++ G +LH +I++ L N + L D Y
Sbjct: 72 IDSVENRGIRPNHQTLKWLLEGCLKTNGSLDEGRKLHSQILKLGL-DSNGCLSEKLFDFY 130

Query: 245 IKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYV 66
+ G L A KVFD +P R + +W +I A +FG F RMVSENV PN T+
Sbjct: 131 LFKGDLYGAFKVFDEMPERTIFTWNKMIKELASRNLIGEVFGLFVRMVSENVTPNEGTFS 190

Query: 65 IVLNACR 45
VL ACR
Sbjct: 191 GVLEACR 197



Score = 75.9 bits (185), Expect = 1e-13
Identities = 44/157 (28%), Positives = 74/157 (47%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN ++ Y + +MQ E + P T+ LK C +E GE++H +
Sbjct: 456 VLWNVMLVAYGLLDDLRNSFRIFRQMQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQ 515

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
I++ N+ V + L+DMY K G L A + ++VVSWT +IAGY + D
Sbjct: 516 IIKTNFQ-LNAYVCSVLIDMYAKLGKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDK 574

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
+F +M+ ++ + V ++AC L + E Q
Sbjct: 575 ALTTFRQMLDRGIRSDEVGLTNAVSACAGLQALKEGQ 611



Score = 70.1 bits (170), Expect = 6e-12
Identities = 36/140 (25%), Positives = 68/140 (48%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ W +IAGY Q+ ++AL +M G+ V A+ AC A++ G+++H +
Sbjct: 557 VSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVGLTNAVSACAGLQALKEGQQIHAQ 616

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
+ ALV +Y +CG + ++ F+ A + ++W AL++G+ + G ++
Sbjct: 617 ACVSGF-SSDLPFQNALVTLYSRCGKIEESYLAFEQTEAGDNIAWNALVSGFQQSGNNEE 675

Query: 128 IFGSFNRMVSENVKPNLVTY 69
F RM E + N T+
Sbjct: 676 ALRVFVRMNREGIDNNNFTF 695



Score = 66.2 bits (160), Expect = 8e-11
Identities = 42/155 (27%), Positives = 74/155 (47%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
W +I+G ++ A+ M G+ PT F+ L AC ++E GE+LHG ++
Sbjct: 256 WVAMISGLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIESLEIGEQLHGLVL 315

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ ++ V ALV +Y G L A+ +F + R+ V++ LI G ++ G +
Sbjct: 316 KLG-FSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRDAVTYNTLINGLSQCGYGEKAM 374

Query: 122 GSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F RM + ++P+ T ++ AC G + Q
Sbjct: 375 ELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQ 409



Score = 65.5 bits (158), Expect = 1e-10
Identities = 43/156 (27%), Positives = 76/156 (48%), Gaps = 1/156 (0%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKAC-GSTIAIERG 327
P R+ WN +I RM E ++P TF+ L+AC G ++A +
Sbjct: 147 PERTIFTWNKMIKELASRNLIGEVFGLFVRMVSENVTPNEGTFSGVLEACRGGSVAFDVV 206

Query: 326 EELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAE 147
E++H I+ + L ++VV L+D+Y + G + A++VFD L ++ SW A+I+G ++
Sbjct: 207 EQIHARILYQGLRD-STVVCNPLIDLYSRNGFVDLARRVFDGLRLKDHSSWVAMISGLSK 265

Query: 146 EGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL 39
F M + P + VL+AC+++
Sbjct: 266 NECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKI 301



Score = 59.3 bits (142), Expect = 1e-08
Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 1/114 (0%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++E+ WN +I Y +HG G ALD D+M H + P VT L AC +++G
Sbjct: 756 KNEVSWNAIINAYSKHGFGSEALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAY 815

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPAR-NVVSWTALIA 159
+ L +VDM + G L++A++ +P + + + W L++
Sbjct: 816 FESMNSEYGLSPKPEHYVCVVDMLTRAGLLSRAKEFIQEMPIKPDALVWRTLLS 869


>sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containing
protein At3g49140 OS=Arabidopsis thaliana GN=PCMP-H77
PE=3 SV=1
Length = 686

Score = 122 bits (307), Expect = 7e-28
Identities = 60/164 (36%), Positives = 98/164 (59%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
+S + WN +I Y+++ A++ RM+ +G P AV+ L ACG T A+ G+++
Sbjct: 272 KSLVSWNVMIGVYMKNAMPVEAVELYSRMEADGFEPDAVSITSVLPACGDTSALSLGKKI 331

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG I R++L+ N ++ AL+DMY KCG L KA+ VF+ + +R+VVSWTA+I+ Y GR
Sbjct: 332 HGYIERKKLI-PNLLLENALIDMYAKCGCLEKARDVFENMKSRDVVSWTAMISAYGFSGR 390

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFE 6
F+++ + P+ + +V L AC GL+ E +S F+
Sbjct: 391 GCDAVALFSKLQDSGLVPDSIAFVTTLAACSHAGLLEEGRSCFK 434



Score = 78.2 bits (191), Expect = 2e-14
Identities = 50/151 (33%), Positives = 71/151 (47%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R+ I N +I Y+ +G + M + P TF C LKAC + I G
Sbjct: 101 PERNVIIINVMIRSYVNNGFYGEGVKVFGTMCGCNVRPDHYTFPCVLKACSCSGTIVIGR 160

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
++HG + L VG LV MY KCG L++A+ V D + R+VVSW +L+ GYA+
Sbjct: 161 KIHGSATKVGL-SSTLFVGNGLVSMYGKCGFLSEARLVLDEMSRRDVVSWNSLVVGYAQN 219

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNA 51
R D M S + + T +L A
Sbjct: 220 QRFDDALEVCREMESVKISHDAGTMASLLPA 250



Score = 52.4 bits (124), Expect = 1e-06
Identities = 32/97 (32%), Positives = 47/97 (48%)
Frame = -3

Query: 320 LHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEG 141
+H I+ +L NS +G L+ Y +A A+KVFD +P RNV+ +I Y G
Sbjct: 61 VHSRIILEDLRC-NSSLGVKLMRAYASLKDVASARKVFDEIPERNVIIINVMIRSYVNNG 119

Query: 140 RHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLV 30
+ F M NV+P+ T+ VL AC G +
Sbjct: 120 FYGEGVKVFGTMCGCNVRPDHYTFPCVLKACSCSGTI 156


>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein
At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2
Length = 903

Score = 122 bits (307), Expect = 7e-28
Identities = 57/160 (35%), Positives = 93/160 (58%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN +I+GY+ Q E A RM G++P T+A L C + + G+++H +
Sbjct: 569 VSWNSIISGYVMKEQSEDAQMLFTRMMEMGITPDKFTYATVLDTCANLASAGLGKQIHAQ 628

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
++++EL + T LVDMY KCG L ++ +F+ R+ V+W A+I GYA G+ +
Sbjct: 629 VIKKELQSDVYICST-LVDMYSKCGDLHDSRLMFEKSLRRDFVTWNAMICGYAHHGKGEE 687

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYF 9
F RM+ EN+KPN VT++ +L AC +GL+++ YF
Sbjct: 688 AIQLFERMILENIKPNHVTFISILRACAHMGLIDKGLEYF 727



Score = 84.3 bits (207), Expect = 3e-16
Identities = 49/155 (31%), Positives = 76/155 (49%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +++GYLQ+G+ ++++ M EG+ TFA LK C G
Sbjct: 141 PVRDVVSWNSMLSGYLQNGESLKSIEVFVDMGREGIEFDGRTFAIILKVCSFLEDTSLGM 200

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
++HG I+ R + V +AL+DMY K ++ +VF +P +N VSW+A+IAG +
Sbjct: 201 QIHG-IVVRVGCDTDVVAASALLDMYAKGKRFVESLRVFQGIPEKNSVSWSAIIAGCVQN 259

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL 39
F M N + Y VL +C L
Sbjct: 260 NLLSLALKFFKEMQKVNAGVSQSIYASVLRSCAAL 294



Score = 82.4 bits (202), Expect = 1e-15
Identities = 45/145 (31%), Positives = 75/145 (51%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
+N +I GY Q G +AL R+ GL ++ + +AC + G +++G +
Sbjct: 350 YNAMITGYSQEEHGFKALLLFHRLMSSGLGFDEISLSGVFRACALVKGLSEGLQIYGLAI 409

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ L + V A +DMY KC ALA+A +VFD + R+ VSW A+IA + + G+
Sbjct: 410 KSSL-SLDVCVANAAIDMYGKCQALAEAFRVFDEMRRRDAVSWNAIIAAHEQNGKGYETL 468

Query: 122 GSFNRMVSENVKPNLVTYVIVLNAC 48
F M+ ++P+ T+ +L AC
Sbjct: 469 FLFVSMLRSRIEPDEFTFGSILKAC 493



Score = 82.4 bits (202), Expect = 1e-15
Identities = 53/173 (30%), Positives = 81/173 (46%), Gaps = 20/173 (11%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + WN +IA + Q+G+G L M + P TF LKAC ++ G E+
Sbjct: 446 RDAVSWNAIIAAHEQNGKGYETLFLFVSMLRSRIEPDEFTFGSILKACTGG-SLGYGMEI 504

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPAR-NV-------------- 183
H I++ + NS VG +L+DMY KCG + +A+K+ R NV
Sbjct: 505 HSSIVKSGM-ASNSSVGCSLIDMYSKCGMIEEAEKIHSRFFQRANVSGTMEELEKMHNKR 563

Query: 182 -----VSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL 39
VSW ++I+GY + + + F RM+ + P+ TY VL+ C L
Sbjct: 564 LQEMCVSWNSIISGYVMKEQSEDAQMLFTRMMEMGITPDKFTYATVLDTCANL 616



Score = 69.7 bits (169), Expect = 7e-12
Identities = 45/165 (27%), Positives = 79/165 (47%), Gaps = 1/165 (0%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P ++ + W+ +IAG +Q+ AL MQ + +A L++C + + G
Sbjct: 242 PEKNSVSWSAIIAGCVQNNLLSLALKFFKEMQKVNAGVSQSIYASVLRSCAALSELRLGG 301

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+LH ++ + + +V TA +DMY KC + AQ +FD N S+ A+I GY++E
Sbjct: 302 QLHAHALKSDFAA-DGIVRTATLDMYAKCDNMQDAQILFDNSENLNRQSYNAMITGYSQE 360

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL-GLVNEAQSY 12
F+R++S + + ++ V AC + GL Q Y
Sbjct: 361 EHGFKALLLFHRLMSSGLGFDEISLSGVFRACALVKGLSEGLQIY 405



Score = 58.2 bits (139), Expect = 2e-08
Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + WN +I GY HG+GE A+ +RM E + P VTF L+AC I++G E
Sbjct: 667 RDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISILRACAHMGLIDKGLEY 726

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLP-ARNVVSWTALI 162
+ R L + +VD+ K G + +A ++ +P + V W L+
Sbjct: 727 FYMMKRDYGLDPQLPHYSNMVDILGKSGKVKRALELIREMPFEADDVIWRTLL 779



Score = 48.9 bits (115), Expect = 1e-05
Identities = 28/118 (23%), Positives = 55/118 (46%)
Frame = -3

Query: 401 GLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTALVDMYIKCGALAK 222
G PT C L+ ++ + ++ R+++ N +++ Y K + K
Sbjct: 78 GFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNK-----MINGYSKSNDMFK 132

Query: 221 AQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
A F+++P R+VVSW ++++GY + G F M E ++ + T+ I+L C
Sbjct: 133 ANSFFNMMPVRDVVSWNSMLSGYLQNGESLKSIEVFVDMGREGIEFDGRTFAIILKVC 190


>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing
protein At1g69350, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E66 PE=3 SV=1
Length = 787

Score = 121 bits (304), Expect = 2e-27
Identities = 61/163 (37%), Positives = 93/163 (57%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
RS + WN ++ G+ Q+G A+ D M H L VTF ++AC S ++E+G+ +
Sbjct: 468 RSVVTWNSMLCGFSQNGNSVEAISLFDYMYHSYLEMNEVTFLAVIQACSSIGSLEKGKWV 527

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
H +++ L K+ TAL+DMY KCG L A+ VF + +R++VSW+++I Y GR
Sbjct: 528 HHKLIISGL--KDLFTDTALIDMYAKCGDLNAAETVFRAMSSRSIVSWSSMINAYGMHGR 585

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYF 9
+FN+MV KPN V ++ VL+AC G V E + YF
Sbjct: 586 IGSAISTFNQMVESGTKPNEVVFMNVLSACGHSGSVEEGKYYF 628



Score = 104 bits (259), Expect = 3e-22
Identities = 50/163 (30%), Positives = 90/163 (55%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + W+ L++ L++G+ +AL M +G+ P AVT ++ C +
Sbjct: 163 PVRDLVAWSTLVSSCLENGEVVKALRMFKCMVDDGVEPDAVTMISVVEGCAELGCLRIAR 222

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+HG+I R+ + + + +L+ MY KCG L ++++F+ + +N VSWTA+I+ Y
Sbjct: 223 SVHGQITRK-MFDLDETLCNSLLTMYSKCGDLLSSERIFEKIAKKNAVSWTAMISSYNRG 281

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQS 15
+ SF+ M+ ++PNLVT VL++C +GL+ E +S
Sbjct: 282 EFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCGLIGLIREGKS 324



Score = 102 bits (254), Expect = 1e-21
Identities = 52/156 (33%), Positives = 82/156 (52%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++ + W +I+ Y + E+AL M G+ P VT L +CG I G+ +
Sbjct: 266 KNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCGLIGLIREGKSV 325

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG +RREL + ALV++Y +CG L+ + V V+ RN+V+W +LI+ YA G
Sbjct: 326 HGFAVRRELDPNYESLSLALVELYAECGKLSDCETVLRVVSDRNIVAWNSLISLYAHRGM 385

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLV 30
G F +MV++ +KP+ T ++AC GLV
Sbjct: 386 VIQALGLFRQMVTQRIKPDAFTLASSISACENAGLV 421



Score = 92.8 bits (229), Expect = 8e-19
Identities = 45/160 (28%), Positives = 88/160 (55%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R+ + WN LI+ Y G +AL +M + + P A T A ++ AC + + G+++
Sbjct: 368 RNIVAWNSLISLYAHRGMVIQALGLFRQMVTQRIKPDAFTLASSISACENAGLVPLGKQI 427

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG ++R ++ + V +L+DMY K G++ A VF+ + R+VV+W +++ G+++ G
Sbjct: 428 HGHVIRTDV--SDEFVQNSLIDMYSKSGSVDSASTVFNQIKHRSVVTWNSMLCGFSQNGN 485

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F+ M ++ N VT++ V+ AC +G + + +
Sbjct: 486 SVEAISLFDYMYHSYLEMNEVTFLAVIQACSSIGSLEKGK 525



Score = 79.0 bits (193), Expect = 1e-14
Identities = 46/143 (32%), Positives = 79/143 (55%), Gaps = 1/143 (0%)
Frame = -3

Query: 440 ERALDCLDRMQHEGLSPTAVTFACALKAC-GSTIAIERGEELHGEIMRRELLGKNSVVGT 264
+ A+D R+ E + F L+AC GS + G ++HG I++ + ++V+ T
Sbjct: 82 DAAIDLYHRLVSETTQISKFVFPSVLRACAGSREHLSVGGKVHGRIIKGGV-DDDAVIET 140

Query: 263 ALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKP 84
+L+ MY + G L+ A+KVFD +P R++V+W+ L++ E G F MV + V+P
Sbjct: 141 SLLCMYGQTGNLSDAEKVFDGMPVRDLVAWSTLVSSCLENGEVVKALRMFKCMVDDGVEP 200

Query: 83 NLVTYVIVLNACRRLGLVNEAQS 15
+ VT + V+ C LG + A+S
Sbjct: 201 DAVTMISVVEGCAELGCLRIARS 223



Score = 30.0 bits (66), Expect = 6.4
Identities = 21/92 (22%), Positives = 41/92 (44%)
Frame = -3

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+LH ++ L ++ + T L++ Y G+ ++ VF+ P + + LI
Sbjct: 19 QLHAHLLVTGRLRRDPLPVTKLIESYAFMGSPDSSRLVFEAFPYPDSFMYGVLIKCNVWC 78

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
D ++R+VSE + + + VL AC
Sbjct: 79 HLLDAAIDLYHRLVSETTQISKFVFPSVLRAC 110


>sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protein
At2g03380, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E47 PE=2 SV=1
Length = 689

Score = 120 bits (301), Expect = 4e-27
Identities = 60/163 (36%), Positives = 90/163 (55%), Gaps = 1/163 (0%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN +I+G+ Q+G AL RM E ++P VT A AC S ++ G LH
Sbjct: 409 VAWNSIISGFSQNGSIHEALFLFHRMNSESVTPNGVTVASLFSACASLGSLAVGSSLHAY 468

Query: 308 IMRRELLGKNSV-VGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHD 132
++ L +SV VGTAL+D Y KCG A+ +FD + +N ++W+A+I GY ++G
Sbjct: 469 SVKLGFLASSSVHVGTALLDFYAKCGDPQSARLIFDTIEEKNTITWSAMIGGYGKQGDTI 528

Query: 131 HIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
F M+ + KPN T+ +L+AC G+VNE + YF S
Sbjct: 529 GSLELFEEMLKKQQKPNESTFTSILSACGHTGMVNEGKKYFSS 571



Score = 97.8 bits (242), Expect = 2e-20
Identities = 48/150 (32%), Positives = 83/150 (55%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R+ +CW +IAGY+++ E L +RM+ + T+ + AC A+ +G+
Sbjct: 205 RNVVCWTSMIAGYVKNDLCEEGLVLFNRMRENNVLGNEYTYGTLIMACTKLSALHQGKWF 264

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG +++ + + +V T+L+DMY+KCG ++ A++VF+ ++V WTA+I GY G
Sbjct: 265 HGCLVKSGIELSSCLV-TSLLDMYVKCGDISNARRVFNEHSHVDLVMWTAMIVGYTHNGS 323

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
+ F +M +KPN VT VL+ C
Sbjct: 324 VNEALSLFQKMKGVEIKPNCVTIASVLSGC 353



Score = 93.2 bits (230), Expect = 6e-19
Identities = 50/151 (33%), Positives = 78/151 (51%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ W +I GY +G AL +M+ + P VT A L CG +E G +HG
Sbjct: 309 VMWTAMIVGYTHNGSVNEALSLFQKMKGVEIKPNCVTIASVLSGCGLIENLELGRSVHGL 368

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
++ + N V ALV MY KC A+ VF++ +++V+W ++I+G+++ G
Sbjct: 369 SIKVGIWDTN--VANALVHMYAKCYQNRDAKYVFEMESEKDIVAWNSIISGFSQNGSIHE 426

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLG 36
F+RM SE+V PN VT + +AC LG
Sbjct: 427 ALFLFHRMNSESVTPNGVTVASLFSACASLG 457



Score = 89.4 bits (220), Expect = 9e-18
Identities = 48/155 (30%), Positives = 83/155 (53%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
W ++ Y + + + D + G + F+ ALKAC ++ G+++H +++
Sbjct: 110 WKVMLRCYCLNKESVEVVKLYDLLMKHGFRYDDIVFSKALKACTELQDLDNGKKIHCQLV 169

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ + ++VV T L+DMY KCG + A KVF+ + RNVV WT++IAGY + +
Sbjct: 170 K--VPSFDNVVLTGLLDMYAKCGEIKSAHKVFNDITLRNVVCWTSMIAGYVKNDLCEEGL 227

Query: 122 GSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
FNRM NV N TY ++ AC +L +++ +
Sbjct: 228 VLFNRMRENNVLGNEYTYGTLIMACTKLSALHQGK 262



Score = 49.7 bits (117), Expect = 8e-06
Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 1/123 (0%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++ I W+ +I GY + G +L+ + M + P TF L ACG T + G++
Sbjct: 509 KNTITWSAMIGGYGKQGDTIGSLELFEEMLKKQQKPNESTFTSILSACGHTGMVNEGKKY 568

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPAR-NVVSWTALIAGYAEEG 141
+ + ++ T +VDM + G L +A + + +P + +V + A + G
Sbjct: 569 FSSMYKDYNFTPSTKHYTCMVDMLARAGELEQALDIIEKMPIQPDVRCFGAFLHGCGMHS 628

Query: 140 RHD 132
R D
Sbjct: 629 RFD 631


>sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protein
At1g20230 OS=Arabidopsis thaliana GN=PCMP-H21 PE=2 SV=2
Length = 760

Score = 119 bits (298), Expect = 8e-27
Identities = 57/161 (35%), Positives = 94/161 (58%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ W +IAG Q+G+ AL+ MQ G+ P VT L ACG+ A+ G HG
Sbjct: 354 VSWTSIIAGCAQNGKDIEALELFREMQVAGVKPNHVTIPSMLPACGNIAALGHGRSTHGF 413

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
+R LL N VG+AL+DMY KCG + +Q VF+++P +N+V W +L+ G++ G+
Sbjct: 414 AVRVHLLD-NVHVGSALIDMYAKCGRINLSQIVFNMMPTKNLVCWNSLMNGFSMHGKAKE 472

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFE 6
+ F ++ +KP+ +++ +L+AC ++GL +E YF+
Sbjct: 473 VMSIFESLMRTRLKPDFISFTSLLSACGQVGLTDEGWKYFK 513



Score = 79.0 bits (193), Expect = 1e-14
Identities = 52/193 (26%), Positives = 89/193 (46%), Gaps = 35/193 (18%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WNG+++G+ + G + A+ ++ H G P VT + L + G + + G +HG
Sbjct: 218 VSWNGILSGFNRSGYHKEAVVMFQKIHHLGFCPDQVTVSSVLPSVGDSEMLNMGRLIHGY 277

Query: 308 IMRRELLGKNSVVGTALVDMYIKCG-------------------------------ALAK 222
++++ LL K+ V +A++DMY K G + K
Sbjct: 278 VIKQGLL-KDKCVISAMIDMYGKSGHVYGIISLFNQFEMMEAGVCNAYITGLSRNGLVDK 336

Query: 221 AQKVFDVLPAR----NVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLN 54
A ++F++ + NVVSWT++IAG A+ G+ F M VKPN VT +L
Sbjct: 337 ALEMFELFKEQTMELNVVSWTSIIAGCAQNGKDIEALELFREMQVAGVKPNHVTIPSMLP 396

Query: 53 ACRRLGLVNEAQS 15
AC + + +S
Sbjct: 397 ACGNIAALGHGRS 409



Score = 64.3 bits (155), Expect = 3e-10
Identities = 38/144 (26%), Positives = 73/144 (50%)
Frame = -3

Query: 437 RALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTAL 258
+++ RM GL P + K C A + G+++H + L ++ V ++
Sbjct: 99 QSIGVFSRMFSHGLIPDSHVLPNLFKVCAELSAFKVGKQIHC-VSCVSGLDMDAFVQGSM 157

Query: 257 VDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNL 78
MY++CG + A+KVFD + ++VV+ +AL+ YA +G + + + M S ++ N+
Sbjct: 158 FHMYMRCGRMGDARKVFDRMSDKDVVTCSALLCAYARKGCLEEVVRILSEMESSGIEANI 217

Query: 77 VTYVIVLNACRRLGLVNEAQSYFE 6
V++ +L+ R G EA F+
Sbjct: 218 VSWNGILSGFNRSGYHKEAVVMFQ 241



Score = 45.4 bits (106), Expect = 1e-04
Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 2/165 (1%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P ++ +CWN L+ G+ HG+ + + + + L P ++F L ACG + G
Sbjct: 450 PTKNLVCWNSLMNGFSMHGKAKEVMSIFESLMRTRLKPDFISFTSLLSACGQVGLTDEGW 509

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPAR-NVVSWTALIAGYAE 147
+ + + + +V++ + G L +A + +P + W AL+
Sbjct: 510 KYFKMMSEEYGIKPRLEHYSCMVNLLGRAGKLQEAYDLIKEMPFEPDSCVWGALLNSCRL 569

Query: 146 EGRHDHIFGSFNRMVSENVKP-NLVTYVIVLNACRRLGLVNEAQS 15
+ D + ++ +++P N TYV++ N G+ E S
Sbjct: 570 QNNVDLAEIAAEKLF--HLEPENPGTYVLLSNIYAAKGMWTEVDS 612


tr_hit_id Q5W964
Definition tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens
Align length 167
Score (bit) 139.0
E-value 1.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915279|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_F06.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 139 1e-31
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 137 3e-31
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 136 6e-31
tr|A7R5A5|A7R5A5_VITVI Chromosome undetermined scaffold_923, who... 134 3e-30
tr|A7QWP3|A7QWP3_VITVI Chromosome chr4 scaffold_205, whole genom... 134 3e-30
tr|Q0JJU9|Q0JJU9_ORYSJ Os01g0715700 protein OS=Oryza sativa subs... 133 4e-30
tr|B8A8P4|B8A8P4_ORYSI Putative uncharacterized protein OS=Oryza... 133 4e-30
tr|A2ZX81|A2ZX81_ORYSJ Putative uncharacterized protein OS=Oryza... 133 4e-30
tr|A7PID2|A7PID2_VITVI Chromosome chr13 scaffold_17, whole genom... 132 7e-30
tr|A7P3N5|A7P3N5_VITVI Chromosome chr1 scaffold_5, whole genome ... 132 9e-30
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 131 2e-29
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 131 2e-29
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 131 2e-29
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 131 2e-29
tr|Q67VS6|Q67VS6_ORYSJ Os06g0625800 protein OS=Oryza sativa subs... 130 3e-29
tr|A3BDQ5|A3BDQ5_ORYSJ Putative uncharacterized protein OS=Oryza... 130 3e-29
tr|Q5QMM7|Q5QMM7_ORYSJ Putative uncharacterized protein P0419B01... 130 4e-29
tr|Q0JPW4|Q0JPW4_ORYSJ Os01g0197500 protein OS=Oryza sativa subs... 130 4e-29
tr|A2WLP8|A2WLP8_ORYSI Putative uncharacterized protein OS=Oryza... 130 4e-29
tr|Q0DJA4|Q0DJA4_ORYSJ Os05g0307200 protein OS=Oryza sativa subs... 129 6e-29
tr|B8AWD0|B8AWD0_ORYSI Putative uncharacterized protein OS=Oryza... 129 6e-29
tr|A7QUQ9|A7QUQ9_VITVI Chromosome chr1 scaffold_180, whole genom... 128 1e-28
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 128 2e-28
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 128 2e-28
tr|Q0E0F3|Q0E0F3_ORYSJ Os02g0555100 protein OS=Oryza sativa subs... 127 3e-28
tr|A3A7Z5|A3A7Z5_ORYSJ Putative uncharacterized protein OS=Oryza... 127 3e-28
tr|A2X612|A2X612_ORYSI Putative uncharacterized protein OS=Oryza... 127 3e-28
tr|A7Q306|A7Q306_VITVI Chromosome chr12 scaffold_47, whole genom... 127 4e-28
tr|Q8LI18|Q8LI18_ORYSJ Selenium-binding protein-like OS=Oryza sa... 126 5e-28
tr|Q0D563|Q0D563_ORYSJ Os07g0578800 protein OS=Oryza sativa subs... 126 5e-28

>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 139 bits (349), Expect = 1e-31
Identities = 68/167 (40%), Positives = 97/167 (58%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAG++QHG+ + A D MQ G+ P +TF L AC S A+ G
Sbjct: 576 PKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGR 635

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
LH ++ + +VGT L+ MY KCG++ A +VF LP +NV SWT++IAGYA+
Sbjct: 636 RLHA-LITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQH 694

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
GR F +M E VKP+ +T+V L+AC GL+ E +F+S
Sbjct: 695 GRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQS 741



Score = 132 bits (333), Expect = 7e-30
Identities = 62/152 (40%), Positives = 95/152 (62%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + W +I G +HG+ ++A + RM+ EG+ P V F L+AC A+E+G+
Sbjct: 273 PTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGK 332

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
++H M+ VGTA++ MY KCG++ A +VFD++ RNVVSWTA+IAG+A+
Sbjct: 333 KVHAR-MKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQH 391

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
GR D F FN+M+ ++PN VT++ +L AC
Sbjct: 392 GRIDEAFLFFNKMIESGIEPNRVTFMSILGAC 423



Score = 117 bits (294), Expect = 2e-25
Identities = 54/151 (35%), Positives = 89/151 (58%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R+ + W +IAG+ QHG+ + A ++M G+ P VTF L AC S A++RG+++
Sbjct: 376 RNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQI 435

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
I+ G + V TAL+ MY KCG+L A +VF+ + +NVV+W A+I Y + +
Sbjct: 436 QDHIIEAGY-GSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQ 494

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACR 45
+D+ +F ++ E +KPN T+ +LN C+
Sbjct: 495 YDNALATFQALLKEGIKPNSSTFTSILNVCK 525



Score = 114 bits (285), Expect = 3e-24
Identities = 58/145 (40%), Positives = 84/145 (57%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
WN L+ GY+QHG E A ++M + + P TF L AC +++G EL+ I+
Sbjct: 179 WNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLIL 238

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ + VGTAL++M+IKCG + A KVFD LP R++V+WT++I G A GR
Sbjct: 239 KAGW-DTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQAC 297

Query: 122 GSFNRMVSENVKPNLVTYVIVLNAC 48
F RM E V+P+ V +V +L AC
Sbjct: 298 NLFQRMEEEGVQPDKVAFVSLLRAC 322



Score = 108 bits (269), Expect = 2e-22
Identities = 52/147 (35%), Positives = 84/147 (57%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN +I Y+QH Q + AL + EG+ P + TF L C S+ ++E G+ +H
Sbjct: 480 VAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFL 539

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
IM+ L + V ALV M++ CG L A+ +F+ +P R++VSW +IAG+ + G++
Sbjct: 540 IMKAGL-ESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQV 598

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNAC 48
F F M +KP+ +T+ +LNAC
Sbjct: 599 AFDYFKMMQESGIKPDKITFTGLLNAC 625



Score = 76.6 bits (187), Expect = 6e-13
Identities = 40/144 (27%), Positives = 76/144 (52%)
Frame = -3

Query: 479 NGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMR 300
N ++ + GQ A+ L+R+ + T++ L+ C + GE ++ I +
Sbjct: 79 NAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHI-K 137

Query: 299 RELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFG 120
+ + + + L++MY KCG A+++FD + ++V SW L+ GY + G ++ F
Sbjct: 138 KSGVQPDIFMRNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFK 197

Query: 119 SFNRMVSENVKPNLVTYVIVLNAC 48
+MV ++VKP+ T+V +LNAC
Sbjct: 198 LHEQMVQDSVKPDKRTFVSMLNAC 221


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 137 bits (345), Expect = 3e-31
Identities = 67/167 (40%), Positives = 96/167 (57%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAG++QHG+ + A D MQ G+ P +TF L AC S A+ G
Sbjct: 576 PKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKITFTGLLNACASPEALTEGR 635

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
LH ++ + +VGT L+ MY KCG++ A +VF LP +NV SWT++I GYA+
Sbjct: 636 RLHA-LITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQH 694

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
GR F +M E VKP+ +T+V L+AC GL+ E +F+S
Sbjct: 695 GRGKEALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQS 741



Score = 132 bits (333), Expect = 7e-30
Identities = 62/152 (40%), Positives = 95/152 (62%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + W +I G +HG+ ++A + RM+ EG+ P V F L+AC A+E+G+
Sbjct: 273 PTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGK 332

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
++H M+ VGTA++ MY KCG++ A +VFD++ RNVVSWTA+IAG+A+
Sbjct: 333 KVHAR-MKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQH 391

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
GR D F FN+M+ ++PN VT++ +L AC
Sbjct: 392 GRIDEAFLFFNKMIESGIEPNRVTFMSILGAC 423



Score = 117 bits (294), Expect = 2e-25
Identities = 54/151 (35%), Positives = 89/151 (58%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R+ + W +IAG+ QHG+ + A ++M G+ P VTF L AC S A++RG+++
Sbjct: 376 RNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMSILGACSSPSALKRGQQI 435

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
I+ G + V TAL+ MY KCG+L A +VF+ + +NVV+W A+I Y + +
Sbjct: 436 QDHIIEAGY-GSDDRVRTALLSMYAKCGSLKDAHRVFEKISKQNVVAWNAMITAYVQHEQ 494

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACR 45
+D+ +F ++ E +KPN T+ +LN C+
Sbjct: 495 YDNALATFQALLKEGIKPNSSTFTSILNVCK 525



Score = 114 bits (285), Expect = 3e-24
Identities = 58/145 (40%), Positives = 84/145 (57%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
WN L+ GY+QHG E A ++M + + P TF L AC +++G EL+ I+
Sbjct: 179 WNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLIL 238

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ + VGTAL++M+IKCG + A KVFD LP R++V+WT++I G A GR
Sbjct: 239 KAGW-DTDLFVGTALINMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQAC 297

Query: 122 GSFNRMVSENVKPNLVTYVIVLNAC 48
F RM E V+P+ V +V +L AC
Sbjct: 298 NLFQRMEEEGVQPDKVAFVSLLRAC 322



Score = 108 bits (269), Expect = 2e-22
Identities = 52/147 (35%), Positives = 84/147 (57%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
+ WN +I Y+QH Q + AL + EG+ P + TF L C S+ ++E G+ +H
Sbjct: 480 VAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFL 539

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
IM+ L + V ALV M++ CG L A+ +F+ +P R++VSW +IAG+ + G++
Sbjct: 540 IMKAGL-ESDLHVSNALVSMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQV 598

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNAC 48
F F M +KP+ +T+ +LNAC
Sbjct: 599 AFDYFKMMQESGIKPDKITFTGLLNAC 625



Score = 76.6 bits (187), Expect = 6e-13
Identities = 40/144 (27%), Positives = 76/144 (52%)
Frame = -3

Query: 479 NGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMR 300
N ++ + GQ A+ L+R+ + T++ L+ C + GE ++ I +
Sbjct: 79 NAVLNRLSKAGQFNEAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHI-K 137

Query: 299 RELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFG 120
+ + + + L++MY KCG A+++FD + ++V SW L+ GY + G ++ F
Sbjct: 138 KSGVQPDIFMWNTLINMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFK 197

Query: 119 SFNRMVSENVKPNLVTYVIVLNAC 48
+MV ++VKP+ T+V +LNAC
Sbjct: 198 LHEQMVQDSVKPDKRTFVSMLNAC 221


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 136 bits (342), Expect = 6e-31
Identities = 69/167 (41%), Positives = 100/167 (59%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAGY Q+G G+ A++ +MQ + + P +F L AC S A+E G+
Sbjct: 695 PSRDIVSWNKIIAGYAQNGLGQTAVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGK 754

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+H EI++R+L G + VG AL+ MY KCG+ +AQ+VFD + +NVV+W A+I YA+
Sbjct: 755 RVHAEIVKRKLQG-DVRVGAALISMYAKCGSQGEAQEVFDNIIEKNVVTWNAMINAYAQH 813

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G G FN M E +KP+ T+ +L+AC GLV E F S
Sbjct: 814 GLASKALGFFNCMEKEGIKPDGSTFTSILSACNHAGLVLEGYQIFSS 860



Score = 113 bits (282), Expect = 6e-24
Identities = 56/153 (36%), Positives = 92/153 (60%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R I WN +IAGY + A+ +MQ EG+ P VTF L AC ++ A G+
Sbjct: 392 PKRDLISWNAIIAGYARREDRGEAMRLYKQMQSEGVKPGRVTFLHLLSACANSSAYADGK 451

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+H +I+R + N + AL++MY +CG+L +AQ VF+ AR+V+SW ++IAG+A+
Sbjct: 452 MIHEDILRSGIKS-NGHLANALMNMYRRCGSLMEAQNVFEGTQARDVISWNSMIAGHAQH 510

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACR 45
G ++ + F M +E ++P+ +T+ VL+ C+
Sbjct: 511 GSYETAYKLFQEMQNEELEPDNITFASVLSGCK 543



Score = 112 bits (281), Expect = 8e-24
Identities = 62/161 (38%), Positives = 90/161 (55%), Gaps = 1/161 (0%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R I WN +IAG+ QHG E A MQ+E L P +TFA L C + A+E G+++
Sbjct: 495 RDVISWNSMIAGHAQHGSYETAYKLFQEMQNEELEPDNITFASVLSGCKNPEALELGKQI 554

Query: 317 HGEIMRREL-LGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEG 141
HG I L L N +G AL++MYI+CG+L A+ VF L R+V+SWTA+I G A++G
Sbjct: 555 HGRITESGLQLDVN--LGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQG 612

Query: 140 RHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F +M +E +P T+ +L C ++E +
Sbjct: 613 EDMKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGK 653



Score = 104 bits (260), Expect = 2e-21
Identities = 53/150 (35%), Positives = 85/150 (56%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + +N LIA QHG A + RM+ +G++ T+ L AC ++ A+E G+ +
Sbjct: 293 RDVVVYNALIAALAQHGHNVEAFEQYYRMRSDGVALNRTTYLSILNACSTSKALEAGKLI 352

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
H I + + +G AL+ MY +CG L KA+++F +P R+++SW A+IAGYA
Sbjct: 353 HSHISE-DGHSSDVQIGNALISMYARCGDLPKARELFYTMPKRDLISWNAIIAGYARRED 411

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
+ +M SE VKP VT++ +L+AC
Sbjct: 412 RGEAMRLYKQMQSEGVKPGRVTFLHLLSAC 441



Score = 100 bits (249), Expect = 4e-20
Identities = 53/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + W +I G G+ +A++ +MQ+EG P TF+ LK C S+ ++ G+++
Sbjct: 596 RDVMSWTAMIGGCADQGEDMKAIELFWQMQNEGFRPVKSTFSSILKVCTSSACLDEGKKV 655

Query: 317 HGEIMRR--ELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
I+ EL ++ VG AL+ Y K G++ A++VFD +P+R++VSW +IAGYA+
Sbjct: 656 IAYILNSGYEL---DTGVGNALISAYSKSGSMTDAREVFDKMPSRDIVSWNKIIAGYAQN 712

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
G +M ++V PN ++V +LNAC + E +
Sbjct: 713 GLGQTAVEFAYQMQEQDVVPNKFSFVSLLNACSSFSALEEGK 754



Score = 100 bits (248), Expect = 5e-20
Identities = 53/162 (32%), Positives = 91/162 (56%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R I WN LI+ Y Q G ++A + MQ+ G P +T+ L AC S +E G+
Sbjct: 89 PRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTACYSPAELENGK 148

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
++H +I++ ++ V +L+ MY KCG L +A++VF + R+VVS+ ++ YA++
Sbjct: 149 KIHSQIIKAGYQ-RDPRVQNSLLSMYGKCGDLPRARQVFAGISPRDVVSYNTMLGLYAQK 207

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
G F +M SE + P+ VTY+ +L+A +++E +
Sbjct: 208 AYVKECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGK 249



Score = 85.1 bits (209), Expect = 2e-15
Identities = 50/150 (33%), Positives = 79/150 (52%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + +N ++ Y Q + L +M EG+SP VT+ L A + ++ G+ +
Sbjct: 192 RDVVSYNTMLGLYAQKAYVKECLGLFGQMSSEGISPDKVTYINLLDAFTTPSMLDEGKRI 251

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
H ++ E L + VGTALV M ++CG + A++ F R+VV + ALIA A+ G
Sbjct: 252 H-KLTVEEGLNSDIRVGTALVTMCVRCGDVDSAKQAFKGTADRDVVVYNALIAALAQHGH 310

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
+ F + RM S+ V N TY+ +LNAC
Sbjct: 311 NVEAFEQYYRMRSDGVALNRTTYLSILNAC 340



Score = 71.6 bits (174), Expect = 2e-11
Identities = 33/111 (29%), Positives = 61/111 (54%)
Frame = -3

Query: 380 TFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDV 201
T+ L+ C + + +H +++ +G + + L++MY+KC ++ A +VF
Sbjct: 29 TYVALLQNCTRKRLLPEAKRIHAQMVEA-WVGPDIFLSNLLINMYVKCRSVLDAHQVFKE 87

Query: 200 LPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNAC 48
+P R+V+SW +LI+ YA++G F F M + PN +TY+ +L AC
Sbjct: 88 MPRRDVISWNSLISCYAQQGFKKKAFQLFEEMQNAGFIPNKITYISILTAC 138


>tr|A7R5A5|A7R5A5_VITVI Chromosome undetermined scaffold_923, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00005103001 PE=4 SV=1
Length = 596

Score = 134 bits (336), Expect = 3e-30
Identities = 63/167 (37%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++ + W LIAG+ Q+G+G+ AL ++M+ EG+ P+A TFA L AC I RG+E+
Sbjct: 259 KNTVSWTALIAGFAQNGRGDEALHLFEQMREEGIPPSAFTFASVLSACADLALIARGKEI 318

Query: 317 HGEIMRRELLGK--NSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
HG I+R + N + AL+DMY KCG + A +F + +++VSW +LI G+A+
Sbjct: 319 HGHIIRSTCIDYFCNIFILNALIDMYCKCGQMRSATTLFKGMHEKDIVSWNSLITGFAQN 378

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G + F RM+ +++PN VT++ +L+AC GLV+E +S
Sbjct: 379 GHGEESLAVFERMIEADIRPNHVTFLGLLSACCHTGLVSEGLRILDS 425



Score = 73.6 bits (179), Expect = 5e-12
Identities = 54/188 (28%), Positives = 84/188 (44%), Gaps = 35/188 (18%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRM--QHEGLSPTAVTFACALKACGSTIAIERGEELH 315
+ +N LI+G HG + +L+ M Q + T + +C S A E ++H
Sbjct: 128 VSYNSLISGLGHHGFRKESLNVFKTMLKQCSNVLFDEFTLVSLVGSCASLGAPELLRQVH 187

Query: 314 GEIMRRELLGKNS--VVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTA--------- 168
G + ++G NS ++G AL+D Y KCG + +F +P R+VVSWT+
Sbjct: 188 GAAI---IIGLNSNIIIGNALIDAYGKCGEPDISFSIFSRMPERDVVSWTSMVAAYAQAS 244

Query: 167 ----------------------LIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLN 54
LIAG+A+ GR D F +M E + P+ T+ VL+
Sbjct: 245 RLEDAHWLFSQMQEKNTVSWTALIAGFAQNGRGDEALHLFEQMREEGIPPSAFTFASVLS 304

Query: 53 ACRRLGLV 30
AC L L+
Sbjct: 305 ACADLALI 312



Score = 67.8 bits (164), Expect = 3e-10
Identities = 36/132 (27%), Positives = 68/132 (51%)
Frame = -3

Query: 398 LSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKA 219
L P ++ + C +T ++ G+ LH ++ L+ + + L+D Y KC ++ A
Sbjct: 26 LDPAHQHYSSLISKCITTRHLKLGKLLHSHFIKTALIF-TTFLANRLIDFYSKCDSIQSA 84

Query: 218 QKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRL 39
KVF VLP +N SW +I+ Y+ G +F + ++ + KPNLV+Y +++
Sbjct: 85 HKVFHVLPVKNTHSWNIIISAYSRSG----LFNEAHNLLDQMPKPNLVSYNSLISGLGHH 140

Query: 38 GLVNEAQSYFES 3
G E+ + F++
Sbjct: 141 GFRKESLNVFKT 152


>tr|A7QWP3|A7QWP3_VITVI Chromosome chr4 scaffold_205, whole genome
shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00008739001 PE=4 SV=1
Length = 576

Score = 134 bits (336), Expect = 3e-30
Identities = 63/167 (37%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
++ + W LIAG+ Q+G+G+ AL ++M+ EG+ P+A TFA L AC I RG+E+
Sbjct: 241 KNTVSWTALIAGFAQNGRGDEALHLFEQMREEGIPPSAFTFASVLSACADLALIARGKEI 300

Query: 317 HGEIMRRELLGK--NSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
HG I+R + N + AL+DMY KCG + A +F + +++VSW +LI G+A+
Sbjct: 301 HGHIIRSTCIDYFCNIFILNALIDMYCKCGQMRSATTLFKGMHEKDIVSWNSLITGFAQN 360

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G + F RM+ +++PN VT++ +L+AC GLV+E +S
Sbjct: 361 GHGEESLAVFERMIEADIRPNHVTFLGLLSACCHTGLVSEGLRILDS 407



Score = 73.6 bits (179), Expect = 5e-12
Identities = 54/188 (28%), Positives = 84/188 (44%), Gaps = 35/188 (18%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRM--QHEGLSPTAVTFACALKACGSTIAIERGEELH 315
+ +N LI+G HG + +L+ M Q + T + +C S A E ++H
Sbjct: 110 VSYNSLISGLGHHGFRKESLNVFKTMLKQCSNVLFDEFTLVSLVGSCASLGAPELLRQVH 169

Query: 314 GEIMRRELLGKNS--VVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTA--------- 168
G + ++G NS ++G AL+D Y KCG + +F +P R+VVSWT+
Sbjct: 170 GAAI---IIGLNSNIIIGNALIDAYGKCGEPDISFSIFSRMPERDVVSWTSMVAAYAQAS 226

Query: 167 ----------------------LIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLN 54
LIAG+A+ GR D F +M E + P+ T+ VL+
Sbjct: 227 RLEDAHWLFSQMQEKNTVSWTALIAGFAQNGRGDEALHLFEQMREEGIPPSAFTFASVLS 286

Query: 53 ACRRLGLV 30
AC L L+
Sbjct: 287 ACADLALI 294



Score = 71.6 bits (174), Expect = 2e-11
Identities = 38/138 (27%), Positives = 72/138 (52%)
Frame = -3

Query: 416 RMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTALVDMYIKC 237
R+ +E L P ++ + C +T ++ G+ LH ++ L+ + + L+D Y KC
Sbjct: 2 RIFNENLDPAHQDYSSLISKCITTRHLKLGKLLHSHFIKTALIF-TTFLANRLIDFYSKC 60

Query: 236 GALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVL 57
++ A KVF VLP +N SW +I+ Y+ G +F + ++ + KPNLV+Y ++
Sbjct: 61 DSIQSAHKVFHVLPVKNTHSWNIIISAYSRSG----LFNEAHNLLDQMPKPNLVSYNSLI 116

Query: 56 NACRRLGLVNEAQSYFES 3
+ G E+ + F++
Sbjct: 117 SGLGHHGFRKESLNVFKT 134


>tr|Q0JJU9|Q0JJU9_ORYSJ Os01g0715700 protein OS=Oryza sativa subsp.
japonica GN=Os01g0715700 PE=4 SV=1
Length = 584

Score = 133 bits (335), Expect = 4e-30
Identities = 70/167 (41%), Positives = 97/167 (58%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAGY+ G+ AL D M+H G + VT AL AC A+ERG+
Sbjct: 206 PQRDHVAWNAMIAGYVHTGRSREALRLFDEMRHAGAAVGEVTLVSALTACAQLGALERGK 265

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+H R + + +GTAL+DMY KCGA+A A +VFD + RNV +WT+ ++G A
Sbjct: 266 WVHSCAHSRGMR-LSVTLGTALIDMYSKCGAVAAAMEVFDSMGERNVYTWTSAVSGLAMN 324

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G F RM S V+PN VT+V+VL C GLV+E ++ F+S
Sbjct: 325 GMGRDCLALFKRMESTGVEPNGVTFVVVLRGCSMAGLVDEGRACFDS 371



Score = 52.0 bits (123), Expect = 2e-05
Identities = 30/93 (32%), Positives = 44/93 (47%)
Frame = -3

Query: 296 ELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGS 117
E+ + V TA+V G A+++FD +P R+ V+W A+IAGY GR
Sbjct: 173 EIASPDVVCVTAMVGALATGGEADAARELFDGMPQRDHVAWNAMIAGYVHTGRSREALRL 232

Query: 116 FNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F+ M VT V L AC +LG + +
Sbjct: 233 FDEMRHAGAAVGEVTLVSALTACAQLGALERGK 265


>tr|B8A8P4|B8A8P4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03510 PE=4 SV=1
Length = 706

Score = 133 bits (335), Expect = 4e-30
Identities = 70/167 (41%), Positives = 97/167 (58%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAGY+ G+ AL D M+H G + VT AL AC A+ERG+
Sbjct: 295 PQRDHVAWNAMIAGYVHTGRSREALRLFDEMRHAGAAVGEVTLVSALTACAQLGALERGK 354

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+H R + + +GTAL+DMY KCGA+A A +VFD + RNV +WT+ ++G A
Sbjct: 355 WVHSCAHSRGMR-LSVTLGTALIDMYSKCGAVAAAMEVFDSMGERNVYTWTSAVSGLAMN 413

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G F RM S V+PN VT+V+VL C GLV+E ++ F+S
Sbjct: 414 GMGRDCLALFKRMESTGVEPNGVTFVVVLRGCSMAGLVDEGRACFDS 460



Score = 52.0 bits (123), Expect = 2e-05
Identities = 30/93 (32%), Positives = 44/93 (47%)
Frame = -3

Query: 296 ELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGS 117
E+ + V TA+V G A+++FD +P R+ V+W A+IAGY GR
Sbjct: 262 EIASPDVVCVTAMVGALATGGEADAARELFDGMPQRDHVAWNAMIAGYVHTGRSREALRL 321

Query: 116 FNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F+ M VT V L AC +LG + +
Sbjct: 322 FDEMRHAGAAVGEVTLVSALTACAQLGALERGK 354


>tr|A2ZX81|A2ZX81_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003153 PE=4 SV=1
Length = 699

Score = 133 bits (335), Expect = 4e-30
Identities = 70/167 (41%), Positives = 97/167 (58%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R + WN +IAGY+ G+ AL D M+H G + VT AL AC A+ERG+
Sbjct: 288 PQRDHVAWNAMIAGYVHTGRSREALRLFDEMRHAGAAVGEVTLVSALTACAQLGALERGK 347

Query: 323 ELHGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEE 144
+H R + + +GTAL+DMY KCGA+A A +VFD + RNV +WT+ ++G A
Sbjct: 348 WVHSCAHSRGMR-LSVTLGTALIDMYSKCGAVAAAMEVFDSMGERNVYTWTSAVSGLAMN 406

Query: 143 GRHDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
G F RM S V+PN VT+V+VL C GLV+E ++ F+S
Sbjct: 407 GMGRDCLALFKRMESTGVEPNGVTFVVVLRGCSMAGLVDEGRACFDS 453



Score = 52.0 bits (123), Expect = 2e-05
Identities = 30/93 (32%), Positives = 44/93 (47%)
Frame = -3

Query: 296 ELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGS 117
E+ + V TA+V G A+++FD +P R+ V+W A+IAGY GR
Sbjct: 255 EIASPDVVCVTAMVGALATGGEADAARELFDGMPQRDHVAWNAMIAGYVHTGRSREALRL 314

Query: 116 FNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
F+ M VT V L AC +LG + +
Sbjct: 315 FDEMRHAGAAVGEVTLVSALTACAQLGALERGK 347


>tr|A7PID2|A7PID2_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018296001
PE=4 SV=1
Length = 844

Score = 132 bits (333), Expect = 7e-30
Identities = 61/162 (37%), Positives = 97/162 (59%)
Frame = -3

Query: 488 ICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGE 309
I W L+AGY QHG + +L +Q +GL P ++T A L AC + + G+ +HG
Sbjct: 517 ITWTTLVAGYAQHGLVDESLKHFRELQLKGLKPNSITIASILPACAQSATLSHGKSIHGY 576

Query: 308 IMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDH 129
I+R E++ ++ V AL+DMYIKCG L +++VF L ++++SW +I GY GR
Sbjct: 577 IIRNEIISEDLFVSNALIDMYIKCGLLEYSEQVFRRLHRKDIISWNTIIQGYVIHGRAKT 636

Query: 128 IFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFES 3
SF +M+ E +P+ +T+ VL+AC + G+VNE +F +
Sbjct: 637 ALSSFYQMLDEGFEPDGITFAGVLSACSQAGMVNEGWEHFNN 678



Score = 91.3 bits (225), Expect = 2e-17
Identities = 49/160 (30%), Positives = 85/160 (53%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R+ W +I ++G E+A++ +M G+ + LK+CG+ + RG+
Sbjct: 4 RNLFSWTVMIGACSKNGDAEKAIELYGKMISSGVKADCFLYPLVLKSCGAVKDLRRGQCA 63

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HGE++ LLG + VV +L+DMY+KC + +++VFD + R+V++WT +I GY + GR
Sbjct: 64 HGEVLITGLLG-DVVVMNSLIDMYMKCEMVDDSERVFDEMDIRDVITWTTMIVGYMQMGR 122

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQ 18
M++ V+P+ T VL LG + A+
Sbjct: 123 GLEGLELLKEMLNSQVRPSSATLAGVLPLFSDLGYLELAK 162



Score = 67.4 bits (163), Expect = 4e-10
Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 36/192 (18%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
WN LIAG++ G E AL+ M+ P ++ L S+ + G++LH ++
Sbjct: 383 WNTLIAGFVDVGDFEAALETFSEMKWTNQRPNLESYNLVLPIIESSASSMIGKQLHCMLL 442

Query: 302 RRELLGK-NSVVGTALVDMY-------------------------------IKCGALAKA 219
R E G+ N + TA ++MY +K G L +A
Sbjct: 443 RSE--GEINKFLCTAFINMYGSSENASYAIKLFDSMDSKDLVSWNSIISCLMKGGFLNEA 500

Query: 218 QKVFDVLPAR----NVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNA 51
++F + N ++WT L+AGYA+ G D F + + +KPN +T +L A
Sbjct: 501 SRIFHEMEVAGIEGNTITWTTLVAGYAQHGLVDESLKHFRELQLKGLKPNSITIASILPA 560

Query: 50 CRRLGLVNEAQS 15
C + ++ +S
Sbjct: 561 CAQSATLSHGKS 572



Score = 67.0 bits (162), Expect = 5e-10
Identities = 40/138 (28%), Positives = 62/138 (44%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R I W +I GY+Q G+G L+ L M + + P++ T A L +E +++
Sbjct: 105 RDVITWTTMIVGYMQMGRGLEGLELLKEMLNSQVRPSSATLAGVLPLFSDLGYLELAKQI 164

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
HG + VGTALVD+Y CG L + VFD + ++V W +I Y +
Sbjct: 165 HG-LAAVTGFEYEKHVGTALVDVYGNCGGLYFGRLVFDRVKEKDVSCWNTMIKSYVQANL 223

Query: 137 HDHIFGSFNRMVSENVKP 84
D M + + P
Sbjct: 224 SDEAISLLKFMHLDGIHP 241



Score = 60.1 bits (144), Expect = 6e-08
Identities = 45/171 (26%), Positives = 69/171 (40%), Gaps = 35/171 (20%)
Frame = -3

Query: 485 CWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFAC----------------ALKAC 354
CWN +I Y+Q + A+ L M +G+ P T+ C L C
Sbjct: 210 CWNTMIKSYVQANLSDEAISLLKFMHLDGIHPVKSTWYCFFPHYSKSKFSIHKFLKLIKC 269

Query: 353 GSTIAIERGE-------------ELHGEIMRRELLGK------NSVVGTALVDMYIKCGA 231
++ G E G + L K NS VG++LV MY K
Sbjct: 270 LEHAGVKPGVVPDTLLDQMYENVENVGRVKELHLFFKRSGGISNSSVGSSLVRMYSKFAV 329

Query: 230 LAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNL 78
L AQ++F L + + SW +++A YA G + FN+M ++PN+
Sbjct: 330 LEPAQEIFSCLGVKELDSWNSILACYAHNGYANKASELFNKMRKTGIEPNV 380


>tr|A7P3N5|A7P3N5_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030510001
PE=4 SV=1
Length = 631

Score = 132 bits (332), Expect = 9e-30
Identities = 68/163 (41%), Positives = 93/163 (57%)
Frame = -3

Query: 497 RSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEEL 318
R + WN LIA +Q G +AL M G+ P +VT AL ACG +E GEE+
Sbjct: 220 RDLVAWNALIAVCVQTGFSSKALQSFREMGMAGIKPDSVTIVSALSACGHLGCLETGEEI 279

Query: 317 HGEIMRRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGR 138
+ E R E + N +V A +DM KCG + KA +FD +P RNV+SW+ +I GYA G
Sbjct: 280 Y-EFAREEGIDSNIIVHNARLDMCAKCGDMDKAMNLFDEMPQRNVISWSTVIGGYAVNGE 338

Query: 137 HDHIFGSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYF 9
+ F+RM ++ V+PN VT++ VL+AC G VNE YF
Sbjct: 339 SEKALALFSRMKNQGVQPNYVTFLAVLSACSHTGRVNEGWQYF 381



Score = 93.6 bits (231), Expect = 5e-18
Identities = 51/159 (32%), Positives = 84/159 (52%)
Frame = -3

Query: 482 WNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGEELHGEIM 303
WN ++ GY+++G ++A+ +M+H G+ P TF +KAC + G +HG ++
Sbjct: 124 WNTIMKGYVKNGIPDKAVSVYGKMRHLGVRPDPFTFPFVIKACAELAELWAGLGMHGHVV 183

Query: 302 RRELLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIF 123
+ L + V T L+ MY+K G L A+ +F + R++V+W ALIA + G
Sbjct: 184 KHGLEFV-AAVRTELMIMYVKFGELGCAEFLFGSMVERDLVAWNALIAVCVQTGFSSKAL 242

Query: 122 GSFNRMVSENVKPNLVTYVIVLNACRRLGLVNEAQSYFE 6
SF M +KP+ VT V L+AC LG + + +E
Sbjct: 243 QSFREMGMAGIKPDSVTIVSALSACGHLGCLETGEEIYE 281



Score = 53.5 bits (127), Expect = 5e-06
Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 4/154 (2%)
Frame = -3

Query: 503 PFRSEICWNGLIAGYLQHGQGERALDCLDRMQHEGLSPTAVTFACALKACGSTIAIERGE 324
P R+ I W+ +I GY +G+ E+AL RM+++G+ P VTF L AC T + G
Sbjct: 319 PQRNVISWSTVIGGYAVNGESEKALALFSRMKNQGVQPNYVTFLAVLSACSHTGRVNEGW 378

Query: 323 ELHGEIMRRE--LLGKNSVVGTALVDMYIKCGALAKAQKVFDVLPAR-NVVSWTALIAGY 153
+ + + + + +VD+ + G L +A ++P + W AL+
Sbjct: 379 QYFNFMAQSDDKNIQPRKEHYACMVDLLGRSGHLEEAYNFIKIMPIEADPGIWGALLGAC 438

Query: 152 AEEGRHDHI-FGSFNRMVSENVKPNLVTYVIVLN 54
A H +I G + + P + +Y ++L+
Sbjct: 439 A---IHQNIKLGQHVADLLFELAPEIASYHVLLS 469



Score = 44.7 bits (104), Expect = 0.003
Identities = 29/122 (23%), Positives = 57/122 (46%)
Frame = -3

Query: 404 EGLSPTAVTFACALKACGSTIAIERGEELHGEIMRRELLGKNSVVGTALVDMYIKCGALA 225
+ L T L++C S ++ + +LH ++ L KN+++ T L+ G ++
Sbjct: 51 QSLPITKQALTTLLQSCSSHPSLLK--QLHALLLTTGLSIKNALI-TQLLTSLTLLGDMS 107

Query: 224 KAQKVFDVLPARNVVSWTALIAGYAEEGRHDHIFGSFNRMVSENVKPNLVTYVIVLNACR 45
A+++FD + W ++ GY + G D + +M V+P+ T+ V+ AC
Sbjct: 108 YARQLFDEMHKPRPFLWNTIMKGYVKNGIPDKAVSVYGKMRHLGVRPDPFTFPFVIKACA 167

Query: 44 RL 39
L
Sbjct: 168 EL 169