BP915286
Clone id YMU001_000069_G04
Library
Length 225
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000069_G04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTACAGCTTCTCGACGAGTTTTATCATCAGGAGCAGACTCTAGCATCTTTGCCAGCTCA
ACGACTCCTCCAACTTCAACAAAATTTTTTCTCCTCCTATCATTTGTCGCAATCATAGTT
ATCCTTCGAAGCACCGCTTCGCTTCATAAAGGGATCATTCGAGCGCACAAGAGCAACTGA
TTGCCAGATCAAGCTATCACCCATGATGGGAAACGCGTTGAAGCT
■■Homology search results ■■ -
sp_hit_id Q2QCI8
Definition sp|Q2QCI8|MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio
Align length 35
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915286|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_G04.
(225 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2QCI8|MED12_DANRE Mediator of RNA polymerase II transcriptio... 32 1.3

>sp|Q2QCI8|MED12_DANRE Mediator of RNA polymerase II transcription
subunit 12 OS=Danio rerio GN=med12 PE=2 SV=1
Length = 2173

Score = 31.6 bits (70), Expect = 1.3
Identities = 13/35 (37%), Positives = 22/35 (62%)
Frame = +3

Query: 60 NDSSNFNKIFSPPIICRNHSYPSKHRFAS*RDHSS 164
N S+NF+++FSPP+ C + PS + A ++ S
Sbjct: 676 NSSANFDEMFSPPMHCESKGSPSPEKQAQEQESKS 710


tr_hit_id A9RY04
Definition tr|A9RY04|A9RY04_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 41
Score (bit) 51.2
E-value 7.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915286|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_G04.
(225 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RY04|A9RY04_PHYPA Predicted protein OS=Physcomitrella paten... 51 7e-12
tr|Q6NNI1|Q6NNI1_ARATH At3g56210 OS=Arabidopsis thaliana GN=At3g... 45 0.001
tr|Q9LYM1|Q9LYM1_ARATH Putative uncharacterized protein F18O21_1... 45 0.002
tr|A7Q3S2|A7Q3S2_VITVI Chromosome chr13 scaffold_48, whole genom... 44 0.005
tr|Q75H93|Q75H93_ORYSJ Os03g0665800 protein OS=Oryza sativa subs... 42 0.015
tr|B8ANN0|B8ANN0_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A3AL55|A3AL55_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.015
tr|B7FGI0|B7FGI0_MEDTR Putative uncharacterized protein OS=Medic... 39 0.099

>tr|A9RY04|A9RY04_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_72020 PE=4 SV=1
Length = 218

Score = 51.2 bits (121), Expect(2) = 7e-12
Identities = 25/41 (60%), Positives = 30/41 (73%)
Frame = -2

Query: 125 RITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRREAV 3
R+ MIAT+D +RK V+ GGV L MLE+A DD TRREAV
Sbjct: 122 RLAMIATDDDKRKRIVDAGGVKALLSMLETAADDDTRREAV 162



Score = 42.7 bits (99), Expect(2) = 7e-12
Identities = 18/32 (56%), Positives = 26/32 (81%)
Frame = -1

Query: 219 NAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
N P+MG++++ SV+LV+ DPFMKRSGAS+
Sbjct: 91 NVAPMMGENMVRHSVSLVKVKDPFMKRSGASR 122


>tr|Q6NNI1|Q6NNI1_ARATH At3g56210 OS=Arabidopsis thaliana
GN=At3g56210 PE=2 SV=1
Length = 191

Score = 45.4 bits (106), Expect = 0.001
Identities = 24/50 (48%), Positives = 30/50 (60%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRREAV 3
PL R++ A +D RR VE+GG EL ML SA DDKTR+EA+
Sbjct: 84 PLFKRMGASRLSRFAIDDERRMKVVEMGGAQELLHMLGSAKDDKTRKEAL 133



Score = 38.5 bits (88), Expect = 0.17
Identities = 16/33 (48%), Positives = 23/33 (69%)
Frame = -1

Query: 222 FNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
+ FP +GD+LI QS++L+ DP KR GAS+
Sbjct: 61 YQFFPYLGDNLIHQSISLLHVKDPLFKRMGASR 93


>tr|Q9LYM1|Q9LYM1_ARATH Putative uncharacterized protein F18O21_170
OS=Arabidopsis thaliana GN=F18O21_170 PE=4 SV=1
Length = 112

Score = 45.1 bits (105), Expect = 0.002
Identities = 22/41 (53%), Positives = 28/41 (68%)
Frame = -2

Query: 125 RITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRREAV 3
R++ A +D RR VE+GG EL ML SA DDKTR+EA+
Sbjct: 5 RLSRFAIDDERRMKVVEMGGAQELLHMLGSAKDDKTRKEAL 45


>tr|A7Q3S2|A7Q3S2_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029395001
PE=4 SV=1
Length = 230

Score = 43.5 bits (101), Expect = 0.005
Identities = 22/50 (44%), Positives = 29/50 (58%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRREAV 3
PL R+ A +D RR VE+GG EL ML +A DD+TR+EA+
Sbjct: 124 PLFKRMGASRLARFAIDDERRMKIVEMGGAQELINMLGAAKDDRTRKEAL 173



Score = 38.5 bits (88), Expect = 0.17
Identities = 16/34 (47%), Positives = 24/34 (70%)
Frame = -1

Query: 225 SFNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
++ FP +GD+L+ QSV+L+ DP KR GAS+
Sbjct: 100 AYQFFPYLGDNLLQQSVSLLHVKDPLFKRMGASR 133


>tr|Q75H93|Q75H93_ORYSJ Os03g0665800 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0056E06.19 PE=4 SV=1
Length = 232

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/48 (43%), Positives = 27/48 (56%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRRE 9
PL R+ A +D RR VE+GG EL +LE A DDKTR++
Sbjct: 130 PLFKRMGASRLARFAVDDARRMKVVEMGGAQELLNVLEGAKDDKTRKQ 177



Score = 40.8 bits (94), Expect = 0.034
Identities = 17/33 (51%), Positives = 24/33 (72%)
Frame = -1

Query: 222 FNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
+ FP MGD+L+ QS++L+R DP KR GAS+
Sbjct: 107 YQFFPYMGDNLLQQSISLLRVKDPLFKRMGASR 139


>tr|B8ANN0|B8ANN0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12907 PE=4 SV=1
Length = 226

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/48 (43%), Positives = 27/48 (56%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRRE 9
PL R+ A +D RR VE+GG EL +LE A DDKTR++
Sbjct: 124 PLFKRMGASRLARFAVDDARRMKVVEMGGAQELLNVLEGAKDDKTRKQ 171



Score = 40.8 bits (94), Expect = 0.034
Identities = 17/33 (51%), Positives = 24/33 (72%)
Frame = -1

Query: 222 FNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
+ FP MGD+L+ QS++L+R DP KR GAS+
Sbjct: 101 YQFFPYMGDNLLQQSISLLRVKDPLFKRMGASR 133


>tr|A3AL55|A3AL55_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011527 PE=4 SV=1
Length = 222

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/48 (43%), Positives = 27/48 (56%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRRE 9
PL R+ A +D RR VE+GG EL +LE A DDKTR++
Sbjct: 120 PLFKRMGASRLARFAVDDARRMKVVEMGGAQELLNVLEGAKDDKTRKQ 167



Score = 40.8 bits (94), Expect = 0.034
Identities = 17/33 (51%), Positives = 24/33 (72%)
Frame = -1

Query: 222 FNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
+ FP MGD+L+ QS++L+R DP KR GAS+
Sbjct: 97 YQFFPYMGDNLLQQSISLLRVKDPLFKRMGASR 129


>tr|B7FGI0|B7FGI0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 192

Score = 39.3 bits (90), Expect = 0.099
Identities = 17/33 (51%), Positives = 24/33 (72%)
Frame = -1

Query: 222 FNAFPIMGDSLIWQSVALVRSNDPFMKRSGASK 124
+ FP MG++L+ QSV+L+R DP KR GAS+
Sbjct: 63 YQFFPYMGENLMHQSVSLLRVKDPLFKRMGASR 95



Score = 37.7 bits (86), Expect = 0.29
Identities = 20/50 (40%), Positives = 27/50 (54%)
Frame = -2

Query: 152 PL*SEAVLRRITMIATNDRRRKNFVEVGGVVELAKMLESAPDDKTRREAV 3
PL R+ A +D R VE+GG EL ML +A DD+TR+ A+
Sbjct: 86 PLFKRMGASRLARFAKDDGSRMKIVELGGGKELINMLSTAKDDRTRKAAL 135