BP915289
Clone id YMU001_000069_G07
Library
Length 460
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000069_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTTGGCCAAAAGGGGCCAACCAAGTGGTTAATGTGCATATGTTAAGCTGGTTTGATATGT
AAAGTGTGGAATTCACCTTCCACCCCAACCAGGGCTCAACCCCCATGGAATTACAATAAC
TTGCACCCAAATTAAAGAGGATGTAGACACTCTTGTGTGCTCTATTGAAAATTTACAAGA
TACTGATTGAGAGAAACCTGTGTGTTCAAAATCCACAGCTCATGTCCTCTCCATTGTTGA
GATGGAGAATGCATCCGGTGCTGCTACGTGGCTCGCAGCTTCTGAGCACACAACAGTTGA
TATATGCTGGGAGATGTGTGTCGCCCTCGGATTCGCAAGTTGCGTACGCAGTGTCATAGT
AGACGTCGATACATGCCACATTGCCACAACCGTGGCCTATCTGAGCTTGCAGCTTCCTTG
AAGCTACATGCCTTCCAACTTGTCCTTCGACGCAGAGAGT
■■Homology search results ■■ -
sp_hit_id P0C581
Definition sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan-2 OS=Neurospora crassa
Align length 64
Score (bit) 30.4
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915289|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_G07.
(460 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease... 30 3.8
sp|Q7VVM4|GUAA_BORPE GMP synthase [glutamine-hydrolyzing] OS=Bor... 30 6.5
sp|Q7WK13|GUAA_BORBR GMP synthase [glutamine-hydrolyzing] OS=Bor... 30 6.5
sp|Q8N6F8|WBS27_HUMAN Williams-Beuren syndrome chromosomal regio... 30 6.6
sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with t... 29 8.5
sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=2 29 8.5

>sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease
subunit pan-2 OS=Neurospora crassa GN=pan-2 PE=3 SV=1
Length = 1236

Score = 30.4 bits (67), Expect = 3.8
Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
Frame = +3

Query: 159 ALLKIY-KILIERNLCVQNPQLMSSPLLRWRMHPVLLRGSQLLSTQQLIYAGRCVSPSDS 335
A+L Y K+ +N+ NP + RMHP +L + +++ I+ ++PS+S
Sbjct: 213 AILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNS 272

Query: 336 QVAY 347
QV Y
Sbjct: 273 QVCY 276


>sp|Q7VVM4|GUAA_BORPE GMP synthase [glutamine-hydrolyzing]
OS=Bordetella pertussis GN=guaA PE=3 SV=1
Length = 530

Score = 29.6 bits (65), Expect = 6.5
Identities = 17/40 (42%), Positives = 21/40 (52%)
Frame = -1

Query: 337 CESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMS 218
C EGD ++P YI+ V R E S IL L+ G D S
Sbjct: 200 CGCEGDWNMPDYISEAVARIREQVGSDEVILGLSGGVDSS 239


>sp|Q7WK13|GUAA_BORBR GMP synthase [glutamine-hydrolyzing]
OS=Bordetella bronchiseptica GN=guaA PE=3 SV=1
Length = 530

Score = 29.6 bits (65), Expect = 6.5
Identities = 17/40 (42%), Positives = 21/40 (52%)
Frame = -1

Query: 337 CESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMS 218
C EGD ++P YI+ V R E S IL L+ G D S
Sbjct: 200 CGCEGDWNMPDYISEAVARIREQVGSDEVILGLSGGVDSS 239


>sp|Q8N6F8|WBS27_HUMAN Williams-Beuren syndrome chromosomal region
27 protein OS=Homo sapiens GN=WBSCR27 PE=2 SV=1
Length = 245

Score = 29.6 bits (65), Expect = 6.6
Identities = 18/50 (36%), Positives = 23/50 (46%)
Frame = -3

Query: 455 LRRRTSWKACSFKEAASSDRPRLWQCGMYRRLL*HCVRNLRIRGRHTSPS 306
L RT+W +KEA + RL Q GM+ L+ V L G PS
Sbjct: 165 LTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPS 214


>sp|Q76LX8|ATS13_HUMAN A disintegrin and metalloproteinase with
thrombospondin motifs 13 OS=Homo sapiens GN=ADAMTS13
PE=1 SV=1
Length = 1427

Score = 29.3 bits (64), Expect = 8.5
Identities = 13/43 (30%), Positives = 19/43 (44%)
Frame = -1

Query: 382 NVACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTG 254
N +C+D T + +G PA+ CVL C P + G
Sbjct: 707 NYSCLDQARKELVETVQCQGSQQPPAWPEACVLEPCPPYWAVG 749


>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=2
Length = 2073

Score = 29.3 bits (64), Expect = 8.5
Identities = 14/40 (35%), Positives = 18/40 (45%)
Frame = +2

Query: 263 ATWLAASEHTTVDICWEMCVALGFASCVRSVIVDVDTCHI 382
A WL E +V + GF C+R VIVD H+
Sbjct: 2018 ALWLGGMERLSVAHKLPKAYSTGFIGCIRDVIVDRQELHL 2057


tr_hit_id B6SSS5
Definition tr|B6SSS5|B6SSS5_MAIZE Type II proteinase inhibitor family protein OS=Zea mays
Align length 57
Score (bit) 47.4
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915289|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_G07.
(460 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6SSS5|B6SSS5_MAIZE Type II proteinase inhibitor family prote... 47 4e-04
tr|A3FMA3|A3FMA3_MAIZE Putative serine type endopeptidase inhibi... 47 4e-04
tr|Q6AVT6|Q6AVT6_ORYSJ Os03g0734300 protein OS=Oryza sativa subs... 44 0.004
tr|A2XLR0|A2XLR0_ORYSI Putative uncharacterized protein OS=Oryza... 44 0.004
tr|A7QCG3|A7QCG3_VITVI Chromosome chr12 scaffold_78, whole genom... 37 0.64
tr|Q9C7G9|Q9C7G9_ARATH Putative uncharacterized protein F28P5.12... 33 5.4
tr|Q6NQ47|Q6NQ47_ARATH At1g72060 OS=Arabidopsis thaliana PE=4 SV=1 33 5.4
tr|A4RS49|A4RS49_OSTLU Predicted protein OS=Ostreococcus lucimar... 33 5.4
tr|B4JQ32|B4JQ32_DROGR GH13633 OS=Drosophila grimshawi GN=GH1363... 33 5.4
tr|A9IRB5|A9IRB5_BORPD Putative methyltransferase OS=Bordetella ... 33 9.2
tr|A9B4N5|A9B4N5_HERA2 UbiA prenyltransferase OS=Herpetosiphon a... 33 9.2

>tr|B6SSS5|B6SSS5_MAIZE Type II proteinase inhibitor family protein
OS=Zea mays PE=4 SV=1
Length = 78

Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/57 (40%), Positives = 28/57 (49%)
Frame = -1

Query: 385 GNVACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
G VAC D Y TC S G LPA NCC+ + GC LHL++G +C
Sbjct: 28 GAVACPQFCLDVDYVTCPSSGSEKLPASCNCCM-------TPKGCTLHLSDGTQQTC 77


>tr|A3FMA3|A3FMA3_MAIZE Putative serine type endopeptidase inhibitor
OS=Zea mays PE=4 SV=1
Length = 78

Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/57 (40%), Positives = 28/57 (49%)
Frame = -1

Query: 385 GNVACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
G VAC D Y TC S G LPA NCC+ + GC LHL++G +C
Sbjct: 28 GAVACPQFCLDVDYVTCPSSGSEKLPARCNCCM-------TPKGCTLHLSDGTQQTC 77


>tr|Q6AVT6|Q6AVT6_ORYSJ Os03g0734300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0027J18.15 PE=4 SV=1
Length = 82

Score = 43.9 bits (102), Expect = 0.004
Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
Frame = -1

Query: 385 GNVACIDVYYD-TAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
G C YD Y TC S G HL NCC+ GC+L+LNNG+ ++C
Sbjct: 30 GGKFCPQFCYDGLEYMTCPSTGSQHLKPACNCCI------AGEKGCVLYLNNGQVINC 81


>tr|A2XLR0|A2XLR0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13414 PE=4 SV=1
Length = 82

Score = 43.9 bits (102), Expect = 0.004
Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
Frame = -1

Query: 385 GNVACIDVYYD-TAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
G C YD Y TC S G HL NCC+ GC+L+LNNG+ ++C
Sbjct: 30 GGKFCPQFCYDGLEYMTCPSTGSQHLKPACNCCI------AGEKGCVLYLNNGQVINC 81


>tr|A7QCG3|A7QCG3_VITVI Chromosome chr12 scaffold_78, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035384001
PE=3 SV=1
Length = 143

Score = 36.6 bits (83), Expect = 0.64
Identities = 20/57 (35%), Positives = 26/57 (45%)
Frame = -1

Query: 385 GNVACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
G AC D Y TC S G+ L A NCC+ + C LHL +G ++ C
Sbjct: 93 GAKACPLYCLDVDYMTCVSSGEEKLTAPCNCCL-------APKQCTLHLVDGSEVQC 142


>tr|Q9C7G9|Q9C7G9_ARATH Putative uncharacterized protein F28P5.12
(Putative uncharacterized protein At1g72060)
OS=Arabidopsis thaliana GN=At1g72060 PE=2 SV=1
Length = 81

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/55 (30%), Positives = 23/55 (41%)
Frame = -1

Query: 379 VACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
+AC Y TC S G LP NCC+ + C LHL++ + C
Sbjct: 32 IACPLYCLQVEYMTCPSSGADKLPPRCNCCL-------APKNCTLHLSDSTTIHC 79


>tr|Q6NQ47|Q6NQ47_ARATH At1g72060 OS=Arabidopsis thaliana PE=4 SV=1
Length = 97

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/55 (30%), Positives = 23/55 (41%)
Frame = -1

Query: 379 VACIDVYYDTAYATCESEGDTHLPAYINCCVLRSCEPRSSTGCILHLNNGEDMSC 215
+AC Y TC S G LP NCC+ + C LHL++ + C
Sbjct: 48 IACPLYCLQVEYMTCPSSGADKLPPRCNCCL-------APKNCTLHLSDSTTIHC 95


>tr|A4RS49|A4RS49_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_86314 PE=4 SV=1
Length = 1041

Score = 33.5 bits (75), Expect = 5.4
Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
Frame = +1

Query: 304 MLGDVCRPRIRKLRTQCHSRRRYMPHCHNRGLSEL-AASLKLHAFQLV 444
M D CR R R+LRT+ +RRR P R + E A + H++ L+
Sbjct: 95 MFEDACRLRARELRTRAEARRRRAPSVAKREVGEAEALEREAHSWSLI 142


>tr|B4JQ32|B4JQ32_DROGR GH13633 OS=Drosophila grimshawi GN=GH13633
PE=4 SV=1
Length = 1341

Score = 33.5 bits (75), Expect = 5.4
Identities = 15/44 (34%), Positives = 24/44 (54%)
Frame = +1

Query: 313 DVCRPRIRKLRTQCHSRRRYMPHCHNRGLSELAASLKLHAFQLV 444
+VC+ T C++R RYMP+ HNR + AA + + L+
Sbjct: 87 EVCQYAHANGSTSCYNRNRYMPYNHNRACAAAAAEAAVSSHPLM 130


>tr|A9IRB5|A9IRB5_BORPD Putative methyltransferase OS=Bordetella
petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
GN=Bpet2811 PE=4 SV=1
Length = 556

Score = 32.7 bits (73), Expect = 9.2
Identities = 21/61 (34%), Positives = 31/61 (50%)
Frame = +3

Query: 168 KIYKILIERNLCVQNPQLMSSPLLRWRMHPVLLRGSQLLSTQQLIYAGRCVSPSDSQVAY 347
K ++L++ C L +P L+WR HP L L T+ L A RCV+P ++ Y
Sbjct: 334 KAQRVLVDAP-CSGIGTLRRNPDLKWRQHPEALTELCALQTRILNSAARCVAPG-GRLVY 391

Query: 348 A 350
A
Sbjct: 392 A 392