BP915301
Clone id YMU001_000069_H09
Library
Length 493
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000069_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGAGGTGCTTGCTCCTGATTCAGAGAAGATTATTGAGGGCACATTGAAGCTGGAAGGGCT
GCAATTCTACCTGGATCGGACTCTTCCCAGCCTTGTATCCAAGCATGTGGGGGCCTTTTG
CCGCACCGCACTTGACAACGCTCCAAGCAAACCTGATTTCAATGACGTTTTCTGGGCGAT
TCATTCAGGAGGGCCTGCTATTTTGACTGCAGTTCAAGAGGCACTCGAGCTAAACCCTGA
AAAGCTTGCTGCAAGCCGCCACATTCTCAAGCATTATGGAAACATCTCTGCTTCCACTGT
GCTCTTCGTTTTGGACGAGCTCCGCAAAGCGGATTCGGAAGCGGACAACCAAAGCGACTG
TGAGTGGGGCATTGCGGTGGCGTATGGGCCTGGAGTTACCATTGAAGGAGCCCTTCTCAA
GAGGTGCAAGTGAATCCCCATTTTGCTGAGCAGGAAATTCTATCATATTATAGTGTAGTG
GATGGTTGTGCAG
■■Homology search results ■■ -
sp_hit_id Q9ZRS4
Definition sp|Q9ZRS4|CHSY_CATRO Chalcone synthase OS=Catharanthus roseus
Align length 145
Score (bit) 124.0
E-value 2.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915301|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_H09.
(493 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ZRS4|CHSY_CATRO Chalcone synthase OS=Catharanthus roseus GN... 124 2e-28
sp|O22047|CHSE_IPOPU Chalcone synthase E OS=Ipomoea purpurea GN=... 124 2e-28
sp|O22046|CHSE_IPONI Chalcone synthase E OS=Ipomoea nil GN=CHSE ... 123 4e-28
sp|Q9MB37|CHS7_IPOBA Chalcone synthase DIII OS=Ipomoea batatas G... 123 5e-28
sp|Q9MB41|CHS2_IPOBA Chalcone synthase LF2 OS=Ipomoea batatas GN... 123 5e-28
sp|O22045|CHSD_IPONI Chalcone synthase D OS=Ipomoea nil GN=CHSD ... 122 7e-28
sp|Q9MB39|CHS4_IPOBA Chalcone synthase LF4 OS=Ipomoea batatas GN... 122 9e-28
sp|Q9MB40|CHS3_IPOBA Chalcone synthase LF3 OS=Ipomoea batatas GN... 121 2e-27
sp|Q9MB36|CHS8_IPOBA Chalcone synthase DIV OS=Ipomoea batatas GN... 121 2e-27
sp|Q9MB38|CHS6_IPOBA Chalcone synthase DII OS=Ipomoea batatas GN... 121 2e-27
sp|Q9FSB7|CHS3_RUTGR Chalcone synthase 3 OS=Ruta graveolens GN=C... 120 3e-27
sp|Q9MB33|CHS1_IPOBA Chalcone synthase LF1 OS=Ipomoea batatas GN... 120 3e-27
sp|P30081|CHS7_SOYBN Chalcone synthase 7 OS=Glycine max GN=CHS7 ... 119 6e-27
sp|P49440|CHSY_PHAVU Chalcone synthase 17 OS=Phaseolus vulgaris ... 119 8e-27
sp|Q9MBB1|CHSY_EQUAR Chalcone synthase OS=Equisetum arvense GN=C... 119 8e-27
sp|Q9XJ58|CHS1_CITSI Chalcone synthase 1 OS=Citrus sinensis GN=C... 119 8e-27
sp|P22928|CHSJ_PETHY Chalcone synthase J OS=Petunia hybrida GN=C... 119 1e-26
sp|P51080|CHS7_MEDSA Chalcone synthase (Fragment) OS=Medicago sa... 119 1e-26
sp|P51078|CHS5_MEDSA Chalcone synthase 4-2 OS=Medicago sativa GN... 119 1e-26
sp|P23569|CHSY_PUELO Chalcone synthase OS=Pueraria lobata GN=CHS... 118 1e-26
sp|P30077|CHS9_MEDSA Chalcone synthase 9 OS=Medicago sativa GN=C... 118 1e-26
sp|Q01288|CHS6_PEA Chalcone synthase 6 OS=Pisum sativum GN=CHS6 ... 118 2e-26
sp|P51077|CHS3_MEDSA Chalcone synthase 4-1 OS=Medicago sativa GN... 118 2e-26
sp|Q9SLX9|VPS_PSINU Phloroisovalerophenone synthase OS=Psilotum ... 117 2e-26
sp|P30075|CHS4_MEDSA Chalcone synthase 4 OS=Medicago sativa GN=C... 117 2e-26
sp|P30074|CHS2_MEDSA Chalcone synthase 2 OS=Medicago sativa GN=C... 117 2e-26
sp|P30073|CHS1_MEDSA Chalcone synthase 1 OS=Medicago sativa GN=C... 117 2e-26
sp|P06515|CHSY_ANTMA Chalcone synthase OS=Antirrhinum majus GN=C... 117 3e-26
sp|P51084|CHS2_TRISU Chalcone synthase 2 OS=Trifolium subterrane... 117 3e-26
sp|Q01287|CHS2_PEA Chalcone synthase 2 OS=Pisum sativum GN=CHS2 ... 117 3e-26

>sp|Q9ZRS4|CHSY_CATRO Chalcone synthase OS=Catharanthus roseus
GN=CHS PE=2 SV=1
Length = 389

Score = 124 bits (312), Expect = 2e-28
Identities = 66/145 (45%), Positives = 91/145 (62%), Gaps = 6/145 (4%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSK---PDFNDVF 172
+ L PDS I+G L+ GL F+L + +P L+SK++G ALD A D+N +F
Sbjct: 244 QTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIGK----ALDEAFQPLGISDWNSIF 299

Query: 173 WAIHSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKA---DSEA 343
W H GGPAIL V+E L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA D +
Sbjct: 300 WIAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLS 359

Query: 344 DNQSDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+T+E +L
Sbjct: 360 TTGEGLEWGVLFGFGPGLTVETVVL 384


>sp|O22047|CHSE_IPOPU Chalcone synthase E OS=Ipomoea purpurea
GN=CHSE PE=2 SV=1
Length = 389

Score = 124 bits (312), Expect = 2e-28
Identities = 63/142 (44%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ + PDS I+G L+ GL F+L + +P L+SKH+ A + D+N +FW
Sbjct: 244 QTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIR-DWNSLFWIA 302

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V+E LEL PEKL A+RH+L YGN+S++ VLF+LDE+RKA S+
Sbjct: 303 HPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG 362

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+T+E +L
Sbjct: 363 EGLEWGVLFGFGPGLTVETVVL 384


>sp|O22046|CHSE_IPONI Chalcone synthase E OS=Ipomoea nil GN=CHSE
PE=2 SV=1
Length = 389

Score = 123 bits (309), Expect = 4e-28
Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ + PDS I+G L+ GL F+L + +P L+SKH+ A D+N +FW
Sbjct: 244 QTILPDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIH-DWNSLFWIA 302

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V+E LEL PEKL A+RH+L YGN+S++ VLF+LDE+RKA S+
Sbjct: 303 HPGGPAILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTG 362

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+T+E +L
Sbjct: 363 EGLEWGVLFGFGPGLTVETVVL 384


>sp|Q9MB37|CHS7_IPOBA Chalcone synthase DIII OS=Ipomoea batatas
GN=CHS-DIII PE=2 SV=1
Length = 393

Score = 123 bits (308), Expect = 5e-28
Identities = 66/142 (46%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAPDS I+G L+ GL F+L + +PS+VS ++ C N D+N VFW
Sbjct: 243 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S A
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


>sp|Q9MB41|CHS2_IPOBA Chalcone synthase LF2 OS=Ipomoea batatas
GN=CHS-LF2 PE=2 SV=1
Length = 393

Score = 123 bits (308), Expect = 5e-28
Identities = 66/142 (46%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAPDS I+G L+ GL F+L + +PS+VS ++ C N D+N VFW
Sbjct: 243 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S A
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


>sp|O22045|CHSD_IPONI Chalcone synthase D OS=Ipomoea nil GN=CHSD
PE=2 SV=1
Length = 388

Score = 122 bits (307), Expect = 7e-28
Identities = 64/142 (45%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAPDS I+G L+ GL F+L + +PS+VS ++ C + N D+N +FW
Sbjct: 243 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEK-CLSEAFNPLGISDWNSIFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSE---ADNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


>sp|Q9MB39|CHS4_IPOBA Chalcone synthase LF4 OS=Ipomoea batatas
GN=CHS-LF4 PE=2 SV=1
Length = 393

Score = 122 bits (306), Expect = 9e-28
Identities = 66/140 (47%), Positives = 88/140 (62%), Gaps = 3/140 (2%)
Frame = +2

Query: 8 LAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHS 187
LAPDS I+G L+ GL F+L + +PS+VS ++ C N D+N VFW H
Sbjct: 245 LAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIAHP 303

Query: 188 GGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQSD 358
GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S A
Sbjct: 304 GGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEG 363

Query: 359 CEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 364 LEWGVLFGFGPGLTIETVVL 383


>sp|Q9MB40|CHS3_IPOBA Chalcone synthase LF3 OS=Ipomoea batatas
GN=CHS-LF3 PE=2 SV=1
Length = 388

Score = 121 bits (304), Expect = 2e-27
Identities = 65/142 (45%), Positives = 88/142 (61%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAPDS I+G L+ GL F+L + +PS+VS ++ C N D+N VFW
Sbjct: 243 QTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSE---ADNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


>sp|Q9MB36|CHS8_IPOBA Chalcone synthase DIV OS=Ipomoea batatas
GN=CHS-DIV PE=2 SV=1
Length = 388

Score = 121 bits (303), Expect = 2e-27
Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAP+S I+G L+ GL F+L + +PS+VS ++ C N D+N VFW
Sbjct: 243 QTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S A
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


>sp|Q9MB38|CHS6_IPOBA Chalcone synthase DII OS=Ipomoea batatas
GN=CHS-DII PE=2 SV=1
Length = 393

Score = 121 bits (303), Expect = 2e-27
Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 3/142 (2%)
Frame = +2

Query: 2 EVLAPDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAI 181
+ LAP+S I+G L+ GL F+L + +PS+VS ++ C N D+N VFW
Sbjct: 243 QTLAPNSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEK-CLFEAFNPLGISDWNSVFWIA 301

Query: 182 HSGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA---DNQ 352
H GGPAIL V++ L L PEKL A+RH+L YGN+S++ VLF+LDE+RKA S A
Sbjct: 302 HPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTG 361

Query: 353 SDCEWGIAVAYGPGVTIEGALL 418
EWG+ +GPG+TIE +L
Sbjct: 362 EGLEWGVLFGFGPGLTIETVVL 383


tr_hit_id A9TSD3
Definition tr|A9TSD3|A9TSD3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 141
Score (bit) 134.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915301|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_H09.
(493 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TSD3|A9TSD3_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A7P842|A7P842_VITVI Chromosome chr3 scaffold_8, whole genome ... 131 2e-29
tr|Q7X795|Q7X795_ORYSJ Os10g0484800 protein OS=Oryza sativa subs... 129 6e-29
tr|O23811|O23811_ORYSA YY2 protein (Anther-specific protein YY2)... 129 6e-29
tr|A2Z8N9|A2Z8N9_ORYSI Putative uncharacterized protein OS=Oryza... 129 6e-29
tr|Q8H305|Q8H305_ORYSJ Putative chalcone synthase OS=Oryza sativ... 129 1e-28
tr|Q0D710|Q0D710_ORYSJ Os07g0411300 protein OS=Oryza sativa subs... 129 1e-28
tr|B8B5F1|B8B5F1_ORYSI Putative uncharacterized protein OS=Oryza... 129 1e-28
tr|A3BIW8|A3BIW8_ORYSJ Putative uncharacterized protein OS=Oryza... 129 1e-28
tr|B6TRM1|B6TRM1_MAIZE Chalcone synthase G OS=Zea mays PE=2 SV=1 128 2e-28
tr|B4FUZ6|B4FUZ6_MAIZE Putative uncharacterized protein OS=Zea m... 128 2e-28
tr|B4FBN3|B4FBN3_MAIZE Putative uncharacterized protein OS=Zea m... 128 2e-28
tr|Q76MX1|Q76MX1_IPOPU Chalcone synthase OS=Ipomoea purpurea GN=... 124 2e-27
tr|Q5I6Y2|Q5I6Y2_MARPO Stilbenecarboxylate synthase 1 OS=Marchan... 124 3e-27
tr|O24484|O24484_PINRA Chalcone synthase homolog PrChS1 OS=Pinus... 124 3e-27
tr|Q54AG8|Q54AG8_IPONI Chalcone synthase OS=Ipomoea nil GN=CHS-E... 123 4e-27
tr|Q2WBN0|Q2WBN0_9LAMI Chalcone synthase OS=Misopates orontium G... 123 5e-27
tr|Q9SBS4|Q9SBS4_9LILI Chalcone synthase OS=Lilium hybrid divisi... 122 7e-27
tr|Q94KJ6|Q94KJ6_IPOPU Chalcone synthase OS=Ipomoea purpurea GN=... 122 7e-27
tr|Q94KJ4|Q94KJ4_IPOPU Chalcone synthase OS=Ipomoea purpurea GN=... 122 7e-27
tr|Q54AG9|Q54AG9_IPONI Chalcone synthase OS=Ipomoea nil GN=CHS-D... 122 7e-27
tr|O04934|O04934_IPOPU Chalcone synthase OS=Ipomoea purpurea GN=... 122 7e-27
tr|B4XF28|B4XF28_IPOPU Chalcone synthase D OS=Ipomoea purpurea G... 122 7e-27
tr|A7LP06|A7LP06_ELAOL Naringenin-chalcone synthase OS=Elaeis ol... 122 7e-27
tr|Q68BL6|Q68BL6_MARPA Chalcone synthase-like OS=Marchantia pale... 122 9e-27
tr|Q68BL5|Q68BL5_MARPA Chalcone synthase-like OS=Marchantia pale... 122 9e-27
tr|Q2ACE2|Q2ACE2_SILLA Chalcone synthase OS=Silene latifolia GN=... 122 1e-26
tr|B4G105|B4G105_MAIZE Chalcone synthase OS=Zea mays PE=2 SV=1 122 1e-26
tr|Q6X3Y2|Q6X3Y2_IPOHE Chalcone synthase (Fragment) OS=Ipomoea h... 121 2e-26
tr|Q6X3Y1|Q6X3Y1_IPOTF Chalcone synthase (Fragment) OS=Ipomoea t... 121 2e-26

>tr|A9TSD3|A9TSD3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149790 PE=3 SV=1
Length = 418

Score = 134 bits (336), Expect = 3e-30
Identities = 69/141 (48%), Positives = 93/141 (65%), Gaps = 5/141 (3%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHSGG 193
P + K I+G L EG+ F L R LP L+ ++ FC L A +ND+FWA+H GG
Sbjct: 276 PGTNKTIDGRLSEEGISFKLGRELPKLIESNIQGFCDPILKRAGGLK-YNDIFWAVHPGG 334

Query: 194 PAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELR----KADSEADN-QSD 358
PAIL AVQ+ L+L PEKL +R +L+ YGNIS+ST ++VLD +R K DN ++
Sbjct: 335 PAILNAVQKQLDLAPEKLQTARQVLRDYGNISSSTCIYVLDYMRHQSLKLKEANDNVNTE 394

Query: 359 CEWGIAVAYGPGVTIEGALLK 421
EWG+ +A+GPGVTIEGALL+
Sbjct: 395 PEWGLLLAFGPGVTIEGALLR 415


>tr|A7P842|A7P842_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036027001
PE=3 SV=1
Length = 392

Score = 131 bits (329), Expect = 2e-29
Identities = 63/139 (45%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAP-SKPDFNDVFWAIHSG 190
PD+EK I+G L EG+ F L R LP ++ H+ AFC + N S D+N +FWA+H G
Sbjct: 250 PDTEKTIDGRLTEEGISFKLARELPQIIEDHIEAFCDKLIRNVGFSDEDYNKIFWAVHPG 309

Query: 191 GPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEA--DNQSDCE 364
GPAIL +++ L+L PEKL ASR L YGN S++T+++VL+ + + S+ +Q D E
Sbjct: 310 GPAILNRMEKRLDLLPEKLNASRRALADYGNASSNTIVYVLEYMLEESSKTKRQDQGDGE 369

Query: 365 WGIAVAYGPGVTIEGALLK 421
WG+ +A+GPG+T EG L +
Sbjct: 370 WGLILAFGPGITFEGILAR 388


>tr|Q7X795|Q7X795_ORYSJ Os10g0484800 protein OS=Oryza sativa subsp.
japonica GN=Os10g0484800 PE=2 SV=1
Length = 389

Score = 129 bits (325), Expect = 6e-29
Identities = 63/136 (46%), Positives = 88/136 (64%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHSGG 193
P ++K+I+G + EG+ F L R LP + + FCRT +D K +FNDVFWA+H GG
Sbjct: 254 PGTDKVIDGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIK-EFNDVFWAVHPGG 312

Query: 194 PAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEADNQSDCEWGI 373
PAIL ++ LEL PEKL SR L +YGN+S++TV +VL+ LR D EWG+
Sbjct: 313 PAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLR--DELKKGMIREEWGL 370

Query: 374 AVAYGPGVTIEGALLK 421
+A+GPG+T EG L++
Sbjct: 371 ILAFGPGITFEGMLVR 386


>tr|O23811|O23811_ORYSA YY2 protein (Anther-specific protein YY2)
OS=Oryza sativa GN=OSJNBa0029C15.7 PE=2 SV=1
Length = 389

Score = 129 bits (325), Expect = 6e-29
Identities = 63/136 (46%), Positives = 88/136 (64%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHSGG 193
P ++K+I+G + EG+ F L R LP + + FCRT +D K +FNDVFWA+H GG
Sbjct: 254 PGTDKVIDGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIK-EFNDVFWAVHPGG 312

Query: 194 PAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEADNQSDCEWGI 373
PAIL ++ LEL PEKL SR L +YGN+S++TV +VL+ LR D EWG+
Sbjct: 313 PAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLR--DELKKGMIREEWGL 370

Query: 374 AVAYGPGVTIEGALLK 421
+A+GPG+T EG L++
Sbjct: 371 ILAFGPGITFEGMLVR 386


>tr|A2Z8N9|A2Z8N9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34081 PE=3 SV=1
Length = 389

Score = 129 bits (325), Expect = 6e-29
Identities = 63/136 (46%), Positives = 88/136 (64%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHSGG 193
P ++K+I+G + EG+ F L R LP + + FCRT +D K +FNDVFWA+H GG
Sbjct: 254 PGTDKVIDGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK-EFNDVFWAVHPGG 312

Query: 194 PAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEADNQSDCEWGI 373
PAIL ++ LEL PEKL SR L +YGN+S++TV +VL+ LR D EWG+
Sbjct: 313 PAILNRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLR--DELKKGMIREEWGL 370

Query: 374 AVAYGPGVTIEGALLK 421
+A+GPG+T EG L++
Sbjct: 371 ILAFGPGITFEGMLVR 386


>tr|Q8H305|Q8H305_ORYSJ Putative chalcone synthase OS=Oryza sativa
subsp. japonica GN=P0710F09.124 PE=3 SV=1
Length = 405

Score = 129 bits (323), Expect = 1e-28
Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 7/143 (4%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPD---FNDVFWAIH 184
PD++K I+G L EG++F L R LP ++ +V AFC+ + P D + D+FWA+H
Sbjct: 253 PDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVH 312

Query: 185 SGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVL----DELRKADSEADNQ 352
GGPAILT ++ L L+ KL ASR L+ +GN S++T+++VL +E R+ EA +
Sbjct: 313 PGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEE 372

Query: 353 SDCEWGIAVAYGPGVTIEGALLK 421
DCEWG+ +A+GPG+T EG L +
Sbjct: 373 EDCEWGLILAFGPGITFEGILAR 395


>tr|Q0D710|Q0D710_ORYSJ Os07g0411300 protein OS=Oryza sativa subsp.
japonica GN=Os07g0411300 PE=3 SV=1
Length = 429

Score = 129 bits (323), Expect = 1e-28
Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 7/143 (4%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPD---FNDVFWAIH 184
PD++K I+G L EG++F L R LP ++ +V AFC+ + P D + D+FWA+H
Sbjct: 277 PDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVH 336

Query: 185 SGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVL----DELRKADSEADNQ 352
GGPAILT ++ L L+ KL ASR L+ +GN S++T+++VL +E R+ EA +
Sbjct: 337 PGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEE 396

Query: 353 SDCEWGIAVAYGPGVTIEGALLK 421
DCEWG+ +A+GPG+T EG L +
Sbjct: 397 EDCEWGLILAFGPGITFEGILAR 419


>tr|B8B5F1|B8B5F1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25733 PE=4 SV=1
Length = 405

Score = 129 bits (323), Expect = 1e-28
Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 7/143 (4%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPD---FNDVFWAIH 184
PD++K I+G L EG++F L R LP ++ +V AFC+ + P D + D+FWA+H
Sbjct: 253 PDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVH 312

Query: 185 SGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVL----DELRKADSEADNQ 352
GGPAILT ++ L L+ KL ASR L+ +GN S++T+++VL +E R+ EA +
Sbjct: 313 PGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEE 372

Query: 353 SDCEWGIAVAYGPGVTIEGALLK 421
DCEWG+ +A+GPG+T EG L +
Sbjct: 373 EDCEWGLILAFGPGITFEGILAR 395


>tr|A3BIW8|A3BIW8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_022990 PE=3 SV=1
Length = 410

Score = 129 bits (323), Expect = 1e-28
Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 7/143 (4%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPD---FNDVFWAIH 184
PD++K I+G L EG++F L R LP ++ +V AFC+ + P D + D+FWA+H
Sbjct: 258 PDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVH 317

Query: 185 SGGPAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVL----DELRKADSEADNQ 352
GGPAILT ++ L L+ KL ASR L+ +GN S++T+++VL +E R+ EA +
Sbjct: 318 PGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRREEAAEE 377

Query: 353 SDCEWGIAVAYGPGVTIEGALLK 421
DCEWG+ +A+GPG+T EG L +
Sbjct: 378 EDCEWGLILAFGPGITFEGILAR 400


>tr|B6TRM1|B6TRM1_MAIZE Chalcone synthase G OS=Zea mays PE=2 SV=1
Length = 385

Score = 128 bits (321), Expect = 2e-28
Identities = 61/139 (43%), Positives = 89/139 (64%)
Frame = +2

Query: 14 PDSEKIIEGTLKLEGLQFYLDRTLPSLVSKHVGAFCRTALDNAPSKPDFNDVFWAIHSGG 193
P ++K+I+G + EG+ F L R LP + + FCRT ++ K DFND+FWA+H GG
Sbjct: 245 PGTDKVIDGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK-DFNDIFWAVHPGG 303

Query: 194 PAILTAVQEALELNPEKLAASRHILKHYGNISASTVLFVLDELRKADSEADNQSDCEWGI 373
PAIL ++ L+L PEKL SR L +YGN+S++T+ +VL+ LR D EWG+
Sbjct: 304 PAILNRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLR--DELKKGAISEEWGL 361

Query: 374 AVAYGPGVTIEGALLKRCK 430
+A+GPG+T EG L++ K
Sbjct: 362 ILAFGPGITFEGLLVRGVK 380