BP915326
Clone id YMU001_000070_C02
Library
Length 461
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000070_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TACGGAATAAGTACGAATCAAACTACCCAAAATTCCACACGTCGGTCTTTCAGATAGCCT
ACTATATAGGATGCTACATACTACACCACCTGGCACTGGGCAATGGGCACCATGTTTAAA
ACTTTATACACAAAGACAAAACCATAGAAACTTTATACACAAAGACAAAACCAAAACCAC
AGAGAATAAAAACTGGAGATGGTGCCTCTAAGTAATAAAGTAACCTCCACACAAAAAGGA
GTGAGGACTGGTCACTATAGAAGCAAACATTCAAGAGTGTAGTCTCTTGAAGGCTGAATC
CAAAACATAAGCAGAGAGTCAAGACTGTCTGCTAGAATCGAACTGTAGATACTAGAGTAA
ACAGTGAACACTGAACACCATACGGCATAAGTAACTAACTCTCACCATAGCTCACATCTC
ATGGTCATAAGCAACATCATCTCGTCCTCGTCTCATCCTCA
■■Homology search results ■■ -
sp_hit_id Q9PQ78
Definition sp|Q9PQ78|GCP_UREPA Probable O-sialoglycoprotein endopeptidase OS=Ureaplasma parvum
Align length 66
Score (bit) 30.8
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915326|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_C02.
(461 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9PQ78|GCP_UREPA Probable O-sialoglycoprotein endopeptidase O... 31 2.9
sp|B1AJ51|GCP_UREP2 Probable O-sialoglycoprotein endopeptidase O... 31 2.9
sp|Q7Z410|TMPS9_HUMAN Transmembrane protease, serine 9 OS=Homo s... 29 8.5

>sp|Q9PQ78|GCP_UREPA Probable O-sialoglycoprotein endopeptidase
OS=Ureaplasma parvum GN=gcp PE=3 SV=1
Length = 320

Score = 30.8 bits (68), Expect = 2.9
Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
Frame = +3

Query: 18 SNYPKFHTS--VFQIAYYIGCYILHHLALGNGHHV*NFIHKDKTIETLYTKTKPKPQRIK 191
S++ KF + + +I YY+ Y L+HLA+G G + + K I++L P+ I
Sbjct: 238 SSFQKFAINEIIKKIKYYLNLYKLNHLAIGGGVSANSLLR--KKIQSL-DVISYIPEMIY 294

Query: 192 TGDGAS 209
TGD A+
Sbjct: 295 TGDNAA 300


>sp|B1AJ51|GCP_UREP2 Probable O-sialoglycoprotein endopeptidase
OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 /
NCTC 11736) GN=gcp PE=3 SV=1
Length = 320

Score = 30.8 bits (68), Expect = 2.9
Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
Frame = +3

Query: 18 SNYPKFHTS--VFQIAYYIGCYILHHLALGNGHHV*NFIHKDKTIETLYTKTKPKPQRIK 191
S++ KF + + +I YY+ Y L+HLA+G G + + K I++L P+ I
Sbjct: 238 SSFQKFAINEIIKKIKYYLNLYKLNHLAIGGGVSANSLLR--KKIQSL-DVISYIPEMIY 294

Query: 192 TGDGAS 209
TGD A+
Sbjct: 295 TGDNAA 300


>sp|Q7Z410|TMPS9_HUMAN Transmembrane protease, serine 9 OS=Homo
sapiens GN=TMPRSS9 PE=1 SV=2
Length = 1059

Score = 29.3 bits (64), Expect = 8.5
Identities = 12/40 (30%), Positives = 24/40 (60%)
Frame = +2

Query: 29 KIPHVGLSDSLLYRMLHTTPPGTGQWAPCLKLYTQRQNHR 148
++P GL+ + L R++ + G G+W + L+ +R+ HR
Sbjct: 813 QLPDCGLAPAALTRIVGGSAAGRGEWPWQVSLWLRRREHR 852


tr_hit_id B3W617
Definition tr|B3W617|B3W617_9ACAR NADH dehydrogenase subunit 4 OS=Unionicola foili
Align length 54
Score (bit) 32.7
E-value 9.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915326|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_C02.
(461 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3W617|B3W617_9ACAR NADH dehydrogenase subunit 4 OS=Unionicol... 33 9.2
tr|A7E3I5|A7E3I5_BOMMO Odorant receptor 44 (Fragment) OS=Bombyx ... 33 9.2

>tr|B3W617|B3W617_9ACAR NADH dehydrogenase subunit 4 OS=Unionicola
foili GN=nad4 PE=4 SV=1
Length = 432

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/54 (37%), Positives = 27/54 (50%)
Frame = -2

Query: 322 LTLCLCFGFSLQETTLLNVCFYSDQSSLLFVWRLLYYLEAPSPVFILCGFGFVF 161
L L L F F L L + F+ SS LFV+ + + FI+CG GF+F
Sbjct: 73 LFLELEFNFLLSVALLFSSVFFVFISSNLFVFYVFFEFSILPIFFIICGLGFMF 126


>tr|A7E3I5|A7E3I5_BOMMO Odorant receptor 44 (Fragment) OS=Bombyx
mori GN=Or44 PE=2 SV=1
Length = 179

Score = 32.7 bits (73), Expect = 9.2
Identities = 23/72 (31%), Positives = 35/72 (48%)
Frame = -2

Query: 367 SLFTLVSTVRF*QTVLTLCLCFGFSLQETTLLNVCFYSDQSSLLFVWRLLYYLEAPSPVF 188
S F+L S ++F +V+ LCL +Q ++ N + Q VW +Y VF
Sbjct: 63 SAFSLASALQFMLSVMVLCL---IGIQFLSIENPTSHPMQ----MVWMAIYLTCMLIEVF 115

Query: 187 ILCGFGFVFVYK 152
ILC FG ++K
Sbjct: 116 ILCWFGNELIWK 127