BP915334
Clone id YMU001_000070_C10
Library
Length 473
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000070_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACATCACAAGAGATTCACCTTGCAGATGAAGGATTGCTGGCTGCTTACAAGGAGGAAGAA
GAAGATATAGCAACATCCAAAGACCATGATGAGCAAGAAACTGTGCTTAAAAACATTTCA
GAAAAGCTTGAGGCTCCTGAAAGAGATTTATCTGCCATCAAGAATTCCTATCTTGAAGAA
CTACAAGAGGTGAATTATTTGTTAACAGAGCCTCAAGAAAACAGGGTTCTATCCCAACCT
ACAGTTGCGCAAAAGGATAAGCTTCTTGAGTCTCAACTTCAAGAAACTGAGGCAAGGCTC
GACGAAGAGCCACACCAAGACGAGTCATGTCCTCAACCTGAAGATAGAGAACAGGTAACC
ACTGGCTTGAATAGGCAGAAGGAAGAGGAATATGTGATTACTATTCCAGTAGTTGCTGGT
ACTAATGATGCAGACAAAGACCTCCATAAACAAGCTATTCAGCTTGAGACAAT
■■Homology search results ■■ -
sp_hit_id P35749
Definition sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens
Align length 117
Score (bit) 42.4
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915334|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_C10.
(473 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 42 0.001
sp|P35732|YKF4_YEAST Uncharacterized protein YKL054C OS=Saccharo... 42 0.001
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 42 0.001
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G028077... 42 0.002
sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=... 42 0.002
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH1... 41 0.003
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2... 41 0.003
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 40 0.007
sp|P24711|INVO_TARBA Involucrin OS=Tarsius bancanus GN=IVL PE=2 ... 39 0.009
sp|Q6FWF3|BRE1_CANGA E3 ubiquitin-protein ligase BRE1 OS=Candida... 39 0.012
sp|O13930|SEC2_SCHPO Rab guanine nucleotide exchange factor sec2... 38 0.020
sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus GN=Myh14 PE=2 SV=1 38 0.020
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sa... 38 0.020
sp|Q95337|INVO_TUPGL Involucrin OS=Tupaia glis GN=IVL PE=2 SV=1 37 0.044
sp|Q8WQ86|EB1_DICDI Microtubule-associated protein RP/EB family ... 37 0.044
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 37 0.058
sp|Q60563|SYCP1_MESAU Synaptonemal complex protein 1 (Fragment) ... 36 0.076
sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 36 0.076
sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus GN=Myh10 PE=1 SV=2 36 0.076
sp|O96133|YB145_PLAF7 Uncharacterized protein PFB0145c OS=Plasmo... 36 0.099
sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2 36 0.099
sp|Q6CEV2|SEC16_YARLI COPII coat assembly protein SEC16 OS=Yarro... 36 0.099
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 36 0.099
sp|P14732|LMNB2_CHICK Lamin-B2 OS=Gallus gallus GN=LMNB2 PE=2 SV=1 36 0.099
sp|B2A3V6|CNPD_NATTJ 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 36 0.099
sp|P17536|TPM1_YEAST Tropomyosin-1 OS=Saccharomyces cerevisiae G... 35 0.13
sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus GN=Myh10 PE=1... 35 0.13
sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 35 0.13
sp|P22793|TRHY_SHEEP Trichohyalin OS=Ovis aries GN=TCHH PE=2 SV=2 35 0.17
sp|Q8WML3|MYST4_MACFA Histone acetyltransferase MYST4 OS=Macaca ... 35 0.17

>sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3
Length = 1972

Score = 42.4 bits (98), Expect = 0.001
Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
Frame = +1

Query: 55 EEEDIATSKDH----DEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQEN 222
+EE++ +D E++ +N ++LE L+ KN E+LQ L E +E
Sbjct: 850 QEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEM 909

Query: 223 RVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESC-PQPEDREQVTTGLNRQKEEE 390
RV +A K + LE L E EARL+EE + + + + Q L Q EEE
Sbjct: 910 RV----RLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEE 962


>sp|P35732|YKF4_YEAST Uncharacterized protein YKL054C
OS=Saccharomyces cerevisiae GN=YKL054C PE=1 SV=1
Length = 738

Score = 42.0 bits (97), Expect = 0.001
Identities = 23/113 (20%), Positives = 56/113 (49%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
+EE E K+ ++ L+ + + APE +++ + EE E++ +++EP E++
Sbjct: 323 QEEAEKKEQVKEEEQTAEELEQEQDNVAAPEEEVTVV-----EEKVEISAVISEPPEDQA 377

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEE 387
+ P Q+ + + Q + + ++P Q + QP+ +Q +Q+++
Sbjct: 378 NTVPQPQQQSQQPQQPQQPQQPQQPQQPQQQQQPQQPQQPQQQLQQQQQQQQQ 430



Score = 36.2 bits (82), Expect = 0.076
Identities = 23/116 (19%), Positives = 56/116 (48%), Gaps = 11/116 (9%)
Frame = +1

Query: 40 AAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQE 219
+A ++EEE S++++++ + + EA +++ + EEL++ + P+E
Sbjct: 295 SAQEQEEETAEPSEENEDRVPEVDGEEVQEEAEKKEQVKEEEQTAEELEQEQDNVAAPEE 354

Query: 220 -----------NRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQ 354
+ V+S+P Q + + + Q Q + + ++P Q + QP+ ++Q
Sbjct: 355 EVTVVEEKVEISAVISEPPEDQANTVPQPQQQSQQPQQPQQPQQPQQPQQPQQQQQ 410


>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4
Length = 1979

Score = 42.0 bits (97), Expect = 0.001
Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 8/127 (6%)
Frame = +1

Query: 34 LLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAI-------KNSYLEELQEV 192
LL ++EEE +KD + Q T K +K EA ++L KN E+LQ
Sbjct: 850 LLQVTRQEEE--MQAKDEELQRT--KERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAE 905

Query: 193 NYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESC-PQPEDREQVTTGL 369
L E +E RV +A K + LE L E EAR++EE + + + + +Q L
Sbjct: 906 TELYAEAEEMRV----RLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDL 961

Query: 370 NRQKEEE 390
Q EEE
Sbjct: 962 EEQLEEE 968



Score = 29.3 bits (64), Expect = 9.3
Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 16/167 (9%)
Frame = +1

Query: 19 LADEGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPER---DLSAIKNSYLEELQE 189
LA+E + + + ++D+ K + E L+++ K ER +L+ + E++
Sbjct: 1242 LANE--IRSLSQAKQDVEHKKK--KLEVQLQDLQSKYSDGERVRTELNEKVHKLQIEVEN 1297

Query: 190 VNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQ-------------DESC 330
V LL E + + VA L SQLQ+T+ L EE Q D++
Sbjct: 1298 VTSLLNEAESKNIKLTKDVAT----LGSQLQDTQELLQEETRQKLNVTTKLRQLEDDKNS 1353

Query: 331 PQPEDREQVTTGLNRQKEEEYVITIPVVAGTNDADKDLHKQAIQLET 471
Q + E+V +Q E ++ T+ + +D+ K L + +ET
Sbjct: 1354 LQEQLDEEVEA---KQNLERHISTLTI--QLSDSKKKLQEFTATVET 1395


>sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777
OS=Dictyostelium discoideum GN=DDB_G0280777 PE=4 SV=1
Length = 1823

Score = 41.6 bits (96), Expect = 0.002
Identities = 27/104 (25%), Positives = 53/104 (50%)
Frame = +1

Query: 142 RDLSAIKNSYLEELQEVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQD 321
+ L ++ L++LQ++ L +PQ+ L QP Q +L + QLQ+ ++P Q
Sbjct: 1637 QQLQQLQPQQLQQLQQLQQL--QPQQ---LQQPQQLQPQQLQQQQLQQ-----QQQPQQQ 1686

Query: 322 ESCPQPEDREQVTTGLNRQKEEEYVITIPVVAGTNDADKDLHKQ 453
+ PQ + ++Q +Q++ +Y T +A + DK+ K+
Sbjct: 1687 QQQPQQQPQQQP----QQQQQPQYQTTFQSIASPKEKDKEREKE 1726


>sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=abpD
PE=1 SV=1
Length = 1738

Score = 41.6 bits (96), Expect = 0.002
Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
Frame = +1

Query: 49 KEEEEDIATSKD--HDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQEN 222
KE+EE + + +D+Q LK + EKL E L +K E+N L + Q N
Sbjct: 1340 KEKEEQLLKLQQDFNDQQSQQLKQLEEKLSEKENQLQQLKQE-----NEINQLNQQQQSN 1394

Query: 223 RVLSQPTVAQKDKLLESQLQETEARLDEE 309
++ Q KD+LL+ Q QE + +E+
Sbjct: 1395 EIIQQ----LKDQLLKQQQQEQQENNNEK 1419



Score = 34.3 bits (77), Expect = 0.29
Identities = 31/144 (21%), Positives = 70/144 (48%), Gaps = 15/144 (10%)
Frame = +1

Query: 82 DHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTE--PQENRVLSQPTVAQK 255
DH EQ+ ++I L E + +++ E+ Q+ + L+E Q N+++ + QK
Sbjct: 989 DHKEQQLKQQSIENDLIEKENQIQQLQSQLNEQRQQQSNQLSEKDQQLNQLIEKNQFDQK 1048

Query: 256 DKLL------------ESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYVI 399
++ L E+Q+Q+ +++L+E+ Q +S E +Q+ + + + ++
Sbjct: 1049 EQQLKQQSIENDLFEKENQIQQLQSQLNEQ-RQQQSNQLSEKDQQLNQLIEKNESDQKEQ 1107

Query: 400 TIPVVAGTND-ADKDLHKQAIQLE 468
+ + ND +K+ Q +QL+
Sbjct: 1108 QLKQQSIENDLIEKENQIQQLQLQ 1131


>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11
PE=2 SV=2
Length = 1972

Score = 40.8 bits (94), Expect = 0.003
Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
Frame = +1

Query: 55 EEEDIATSKDH----DEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQEN 222
+EE++ +D E++ ++ ++L+ LS KN E+LQ L E +E
Sbjct: 850 QEEEMQAKEDELQKIKERQQKAESELQELQQKHTQLSEEKNLLQEQLQAETELYAEAEEM 909

Query: 223 RVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESC-PQPEDREQVTTGLNRQKEEE 390
RV +A K + LE L E EARL+EE + + + + Q L Q EEE
Sbjct: 910 RV----RLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEE 962


>sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2
OS=Homo sapiens GN=CHD2 PE=1 SV=2
Length = 1828

Score = 40.8 bits (94), Expect = 0.003
Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 8/88 (9%)
Frame = +1

Query: 202 LTEPQENRVLSQPT--VAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNR 375
L E +EN V + T + + K+ E E L+E PH+D PE++ + R
Sbjct: 1001 LAETRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKDWDEIIPEEQRKKVEEEER 1060

Query: 376 QKEEEYVITIPVV------AGTNDADKD 441
QKE E + +P + A TND+D D
Sbjct: 1061 QKELEEIYMLPRIRSSTKKAQTNDSDSD 1088


>sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1
Length = 1972

Score = 39.7 bits (91), Expect = 0.007
Identities = 38/115 (33%), Positives = 52/115 (45%), Gaps = 1/115 (0%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
KEEE T + + ET LK + +K L+ K E+LQ L E +E RV
Sbjct: 857 KEEEMQKITERQQ-KAETELKELEQK----HTQLAEEKTLLQEQLQAETELYAESEEMRV 911

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESC-PQPEDREQVTTGLNRQKEEE 390
+A K + LE L E EARL+EE + + + + Q L Q EEE
Sbjct: 912 ----RLAAKKQELEEILHEMEARLEEEEDRRQQLQAERKKMAQQMLDLEEQLEEE 962


>sp|P24711|INVO_TARBA Involucrin OS=Tarsius bancanus GN=IVL PE=2
SV=1
Length = 387

Score = 39.3 bits (90), Expect = 0.009
Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 13/148 (8%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
+E+E + ++ QE L +K + E L + E+ + L EPQE +
Sbjct: 104 QEQEAHLGKKQEPQGQEVHLGKQQQKTQEQEVHLGKQQQELQEQEVHLEKQLQEPQEVHL 163

Query: 229 LSQPTVAQKDKLLESQLQETEARLD-----EEPHQDES--------CPQPEDREQVTTGL 369
Q + +++ LE QLQE E L+ +EP + E+ P+P+D E + G
Sbjct: 164 EKQ--LQEQEVHLEKQLQEPEPELNLGKQQQEPQEQEAYLGKQQQELPEPQDPE-LHLGK 220

Query: 370 NRQKEEEYVITIPVVAGTNDADKDLHKQ 453
+Q+ +E + + + + L KQ
Sbjct: 221 QQQEPQEQEVQLEKQQEAQEQELHLGKQ 248


>sp|Q6FWF3|BRE1_CANGA E3 ubiquitin-protein ligase BRE1 OS=Candida
glabrata GN=BRE1 PE=3 SV=1
Length = 693

Score = 38.9 bits (89), Expect = 0.012
Identities = 31/137 (22%), Positives = 67/137 (48%), Gaps = 5/137 (3%)
Frame = +1

Query: 1 TSQEIHLADEGLLAAYKE--EEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYL 174
++ ++ L +E L+ ++E +E+D K + E L+++ + A E+DL ++ +
Sbjct: 318 SNTDLTLTNESFLSKFQELAKEKDTFQEKISSDFEKTLESLKAQNLALEKDLVRVRTTRD 377

Query: 175 EELQEVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQ 354
E + +V L E ++ ++S + Q +L Q ++ E R ++ P D + +D E
Sbjct: 378 ELISKVAILEAETSKSVLISD--LKQALDILRDQWEKIEFRNNQSPSSDALLKEIQDLES 435

Query: 355 V---TTGLNRQKEEEYV 396
+ L +K EY+
Sbjct: 436 AFKELSSLTHKKYSEYL 452


tr_hit_id Q869X5
Definition tr|Q869X5|Q869X5_DICDI Similar to Oryza sativa (Japonica cultivar-group). Putative histone acetyltransferase (HAM group protein) OS=Dictyostelium discoideum
Align length 149
Score (bit) 47.0
E-value 0.0005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915334|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_C10.
(473 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q869X5|Q869X5_DICDI Similar to Oryza sativa (Japonica cultiva... 47 5e-04
tr|Q9DUN0|Q9DUN0_HHV8 Orf73 OS=Human herpesvirus 8 PE=4 SV=1 45 0.001
tr|Q98148|Q98148_HHV8 Kaposi's sarcoma-associated herpes-like vi... 45 0.002
tr|Q76SB0|Q76SB0_HHV8 ORF 73 OS=Human herpesvirus 8 type M PE=4 ... 45 0.002
tr|Q8SWQ7|Q8SWQ7_LOLPE Non-muscle myosin II heavy chain OS=Lolig... 44 0.003
tr|Q9LN21|Q9LN21_ARATH F14O10.11 protein OS=Arabidopsis thaliana... 44 0.005
tr|Q8T5C7|Q8T5C7_PLAFA Erythrocyte binding protein 1 (Chimeric e... 44 0.005
tr|Q8IHP3|Q8IHP3_PLAF7 MAEBL, putative OS=Plasmodium falciparum ... 44 0.005
tr|Q7K5Q6|Q7K5Q6_PLAFA Erythrocyte binding protein 3 OS=Plasmodi... 44 0.005
tr|Q7K5Q5|Q7K5Q5_PLAFA Erythrocyte binding protein 2 OS=Plasmodi... 44 0.005
tr|A6G734|A6G734_9DELT Putative transcriptional regulator OS=Ple... 43 0.007
tr|Q9FHD1|Q9FHD1_ARATH Hyaluronan mediated motility receptor-lik... 43 0.007
tr|Q8IBZ5|Q8IBZ5_PLAF7 Cg7 protein OS=Plasmodium falciparum (iso... 43 0.007
tr|Q17FW7|Q17FW7_AEDAE Putative uncharacterized protein OS=Aedes... 43 0.007
tr|O15802|O15802_PLAFA CG7 OS=Plasmodium falciparum GN=cg7 PE=4 ... 43 0.007
tr|A2EUJ3|A2EUJ3_TRIVA Erythrocyte binding protein, putative OS=... 43 0.007
tr|A1C2A1|A1C2A1_9EUKA Heat shock protein 90 (Fragment) OS=Oxymo... 43 0.007
tr|Q5CHR3|Q5CHR3_CRYHO Integral membrane protein OS=Cryptosporid... 43 0.009
tr|Q54Y28|Q54Y28_DICDI Putative uncharacterized protein OS=Dicty... 43 0.009
tr|Q9QR71|Q9QR71_HHV8 ORF73 OS=Human herpesvirus 8 type P GN=ORF... 42 0.012
tr|Q9DUM3|Q9DUM3_HHV8 Latent nuclear antigen (Fragment) OS=Human... 42 0.012
tr|A8Q6R5|A8Q6R5_BRUMA Kinesin motor domain containing protein O... 42 0.012
tr|A2DDW4|A2DDW4_TRIVA Putative uncharacterized protein OS=Trich... 42 0.012
tr|Q3MNF1|Q3MNF1_HUMAN Smooth muscle myosin heavy chain isoform ... 42 0.012
tr|Q3MNF0|Q3MNF0_HUMAN Myosin, heavy chain 11, smooth muscle OS=... 42 0.012
tr|Q3MIV8|Q3MIV8_HUMAN Myosin, heavy chain 11, smooth muscle OS=... 42 0.012
tr|B1PS43|B1PS43_HUMAN Myosin heavy chain 11 smooth muscle isofo... 42 0.012
tr|Q55SC9|Q55SC9_CRYNE Putative uncharacterized protein OS=Crypt... 42 0.012
tr|Q91LX9|Q91LX9_HHV8 ORF73 OS=Human herpesvirus 8 PE=4 SV=1 42 0.015
tr|O40947|O40947_HHV8 ORF 73 OS=Human herpesvirus 8 PE=4 SV=1 42 0.015

>tr|Q869X5|Q869X5_DICDI Similar to Oryza sativa (Japonica
cultivar-group). Putative histone acetyltransferase (HAM
group protein) OS=Dictyostelium discoideum
GN=DDB_0167422 PE=4 SV=1
Length = 639

Score = 47.0 bits (110), Expect = 5e-04
Identities = 32/149 (21%), Positives = 66/149 (44%), Gaps = 6/149 (4%)
Frame = +1

Query: 25 DEGLLAAYKEEEEDIATSKDHDEQETVLKN------ISEKLEAPERDLSAIKNSYLEELQ 186
DE ++ +EE+E++ ++ E+E + E++E PE + + +EE +
Sbjct: 5 DEDIIMEEEEEDEEVEEEEEEQEEEEEEEEEKEEMVEDEEIEEPEEEEEEEEEKVVEEEE 64

Query: 187 EVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTG 366
E E +E T ++++ E + +E DEE ++E + E+ E+
Sbjct: 65 EEE----EDEEEEEEKVETEELEEEMEEDKEEEETEEKDEEEQEEEEEEEEEEEEEEEEE 120

Query: 367 LNRQKEEEYVITIPVVAGTNDADKDLHKQ 453
+++EE + P+ D KD K+
Sbjct: 121 EEEEEDEEIEVEKPIETNKKDKKKDTAKK 149


>tr|Q9DUN0|Q9DUN0_HHV8 Orf73 OS=Human herpesvirus 8 PE=4 SV=1
Length = 976

Score = 45.4 bits (106), Expect = 0.001
Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLE---ELQEVNYLLTEPQE 219
+EE+E + +EQE L+ ++LE E++L + E EL+E L E ++
Sbjct: 568 QEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 627

Query: 220 NRVLSQPTVAQKDKLLESQ---LQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q L+E E L+E+ + E Q ++ E+V Q+E+E
Sbjct: 628 ELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQE 687



Score = 41.6 bits (96), Expect = 0.020
Identities = 29/114 (25%), Positives = 58/114 (50%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + +EL+E L E ++
Sbjct: 596 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQE----QELEEQEQELEEQEQELE 651

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q QE E EE Q++ + E+ E+ Q+E+E
Sbjct: 652 EQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQEEQE 705



Score = 40.0 bits (92), Expect = 0.058
Identities = 29/116 (25%), Positives = 57/116 (49%), Gaps = 2/116 (1%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEV--NYLLTEPQEN 222
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E QE
Sbjct: 603 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 662

Query: 223 RVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ Q + +++ E + ++ E L+E Q++ Q E EQ + Q+E+E
Sbjct: 663 ELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQE--QEEQEEQELEEVEEQEEQE 716



Score = 39.3 bits (90), Expect = 0.099
Identities = 30/114 (26%), Positives = 53/114 (46%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E + V
Sbjct: 617 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEV 676

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
Q ++ +L E + QE E EE +E E EQ + Q+E+E
Sbjct: 677 EEQEQEQEEQELEEVEEQEQEQEEQEEQELEE---VEEQEEQELEEVEEQEEQE 727



Score = 36.6 bits (83), Expect = 0.64
Identities = 33/142 (23%), Positives = 67/142 (47%), Gaps = 10/142 (7%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLE-----ELQEVNYLLTEP 213
++E+E ++ +EQE L+ ++LE E++L + E EL+EV E
Sbjct: 624 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQ 683

Query: 214 QENRV-----LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQ 378
+E + Q Q+++ LE ++ E L+E Q+E E EQ G+ +Q
Sbjct: 684 EEQELEEVEEQEQEQEEQEEQELEEVEEQEEQELEEVEEQEEQ-ELEEVEEQEQQGVEQQ 742

Query: 379 KEEEYVITIPVVAGTNDADKDL 444
++E + P++ + ++ ++
Sbjct: 743 EQE--TVEEPIILHGSSSEDEM 762



Score = 36.6 bits (83), Expect = 0.64
Identities = 29/130 (22%), Positives = 58/130 (44%), Gaps = 3/130 (2%)
Frame = +1

Query: 37 LAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQ 216
L ++E E+ + EQE + ++LE E + LEE++E E +
Sbjct: 643 LEEQEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQE 702

Query: 217 ENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGL---NRQKEE 387
E + + Q+++ LE ++ E L+E Q++ + +++E V + E+
Sbjct: 703 EQEL--EEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETVEEPIILHGSSSED 760

Query: 388 EYVITIPVVA 417
E + PVV+
Sbjct: 761 EMEVDYPVVS 770



Score = 33.5 bits (75), Expect = 5.4
Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 6/120 (5%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPE------RDLSAIKNSYLEELQEVNYLLTE 210
+EEEED D D ++ +K E E + LS + +E Q+ E
Sbjct: 387 EEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQE 446

Query: 211 PQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
PQ+ Q Q++ L E Q QE + +EP Q E PQ ++ +Q +++E
Sbjct: 447 PQQQEP-QQQEPQQQEPLQEPQQQEPQ---QQEPQQQE--PQQQEPQQQEPQQQEPQQQE 500



Score = 32.7 bits (73), Expect = 9.3
Identities = 25/140 (17%), Positives = 57/140 (40%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E + + +Q+ + ++ E ++D +E Q+ E Q++
Sbjct: 473 QQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQ 532

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYVITIP 408
Q ++ + + Q+ E + DE+ QDE Q E +Q ++E+E
Sbjct: 533 QQDEQEQQDEQEQQDEQQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQE------ 586

Query: 409 VVAGTNDADKDLHKQAIQLE 468
+ +++L +Q +LE
Sbjct: 587 ----LEEQEQELEEQEQELE 602


>tr|Q98148|Q98148_HHV8 Kaposi's sarcoma-associated herpes-like virus
ORF73 homolog OS=Human herpesvirus 8 PE=4 SV=1
Length = 1162

Score = 44.7 bits (104), Expect = 0.002
Identities = 30/117 (25%), Positives = 59/117 (50%), Gaps = 3/117 (2%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLE---ELQEVNYLLTEPQE 219
+E+E+ ++ +EQE L++ ++LE E++L + E EL+E L E ++
Sbjct: 757 EEQEQQEEQEQELEEQEQELEDQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 816

Query: 220 NRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q QE E + EE Q+ + E EQ + Q++E+
Sbjct: 817 ELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQEQ 873



Score = 43.9 bits (102), Expect = 0.004
Identities = 30/114 (26%), Positives = 57/114 (50%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E QE +
Sbjct: 785 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEL-----EEQEQEL 839

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
Q Q+ ++ E + ++ E L+E Q++ Q E EQ + Q+E+E
Sbjct: 840 EEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQE--QEEQEEQELEEVEEQEEQE 891



Score = 43.9 bits (102), Expect = 0.004
Identities = 32/114 (28%), Positives = 54/114 (47%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E QE V
Sbjct: 792 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEV 851

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
Q ++ +L E + QE E EE +E E EQ + Q+E+E
Sbjct: 852 EEQEQEQEEQELEEVEEQEQEQEEQEEQELEE---VEEQEEQELEEVEEQEEQE 902



Score = 42.4 bits (98), Expect = 0.012
Identities = 28/114 (24%), Positives = 57/114 (50%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E + +EQE L+ ++LE E++L + +EL+E L E ++
Sbjct: 750 QDEQEQQEEQEQQEEQEQELEEQEQELEDQEQELEEQE----QELEEQEQELEEQEQELE 805

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q QE E + E Q++ + E EQ +++E+E
Sbjct: 806 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQE 859



Score = 37.0 bits (84), Expect = 0.49
Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 6/106 (5%)
Frame = +1

Query: 52 EEEEDIATSKDHDEQETVLKNISEKLEAPE------RDLSAIKNSYLEELQEVNYLLTEP 213
EEEED D D ++ +K E E + LS + +E Q+ EP
Sbjct: 398 EEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEP 457

Query: 214 QENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDRE 351
Q+ L +P + + Q + + +EP Q E +P+ +E
Sbjct: 458 QQQEPLQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPLQEPQQQE 503



Score = 37.0 bits (84), Expect = 0.49
Identities = 32/140 (22%), Positives = 65/140 (46%), Gaps = 3/140 (2%)
Frame = +1

Query: 7 QEIHLADEGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQ 186
QE+ ++ L EE+E ++ +++E L+ + E+ + E +EL+
Sbjct: 830 QELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQEQEEQEE-------QELE 882

Query: 187 EVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTG 366
EV E QE + L + ++ +L E + QE + L+E Q++ + +++E V
Sbjct: 883 EV-----EEQEEQELEEVEEQEEQELEEVEEQE-QQELEEVEEQEQQGVEQQEQETVEEP 936

Query: 367 L---NRQKEEEYVITIPVVA 417
+ E+E + PVV+
Sbjct: 937 IILHGSSSEDEMEVDYPVVS 956



Score = 35.4 bits (80), Expect = 1.4
Identities = 28/138 (20%), Positives = 66/138 (47%), Gaps = 6/138 (4%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKL---EAPERDLSAIKNSYLEELQEVNYLLTEPQE 219
++E+E ++ +EQE L+ ++L E E++ + +E QE+ + + QE
Sbjct: 813 EQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQE 872

Query: 220 NRVLSQPTVAQKDKLLESQLQETEARLD---EEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + + ++ E +L+E E + + EE + E E EQ G+ +Q++E
Sbjct: 873 QEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQELEEVEEQEQQGVEQQEQE- 931

Query: 391 YVITIPVVAGTNDADKDL 444
+ P++ + ++ ++
Sbjct: 932 -TVEEPIILHGSSSEDEM 948



Score = 35.4 bits (80), Expect = 1.4
Identities = 30/134 (22%), Positives = 61/134 (45%)
Frame = +1

Query: 37 LAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQ 216
L ++E E+ + EQE + + E+ + E + LEE++E E Q
Sbjct: 818 LEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQ-EQEEQ 876

Query: 217 ENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYV 396
E + L + ++ +L E + QE + + E + + + E++EQ Q+E+E V
Sbjct: 877 EEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQELEEVEEQEQQGV---EQQEQETV 933

Query: 397 ITIPVVAGTNDADK 438
++ G++ D+
Sbjct: 934 EEPIILHGSSSEDE 947



Score = 33.9 bits (76), Expect = 4.2
Identities = 29/140 (20%), Positives = 62/140 (44%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E++ +D +Q+ ++ ++ E ++D +E Q+ E Q++
Sbjct: 672 QDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDE--------QEQQDEQEQQDEQQQDEQ 723

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYVITIP 408
Q Q+D E Q Q+ + + DE+ QDE Q E +Q +++E+ +
Sbjct: 724 QQQDEQQQQD---EQQQQDEQQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQEL---- 776

Query: 409 VVAGTNDADKDLHKQAIQLE 468
D +++L +Q +LE
Sbjct: 777 -----EDQEQELEEQEQELE 791


>tr|Q76SB0|Q76SB0_HHV8 ORF 73 OS=Human herpesvirus 8 type M PE=4 SV=1
Length = 1162

Score = 44.7 bits (104), Expect = 0.002
Identities = 30/117 (25%), Positives = 59/117 (50%), Gaps = 3/117 (2%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLE---ELQEVNYLLTEPQE 219
+E+E+ ++ +EQE L++ ++LE E++L + E EL+E L E ++
Sbjct: 757 EEQEQQEEQEQELEEQEQELEDQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 816

Query: 220 NRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q QE E + EE Q+ + E EQ + Q++E+
Sbjct: 817 ELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQEQ 873



Score = 43.9 bits (102), Expect = 0.004
Identities = 30/114 (26%), Positives = 57/114 (50%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E QE +
Sbjct: 785 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQEL-----EEQEQEL 839

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
Q Q+ ++ E + ++ E L+E Q++ Q E EQ + Q+E+E
Sbjct: 840 EEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQE--QEEQEEQELEEVEEQEEQE 891



Score = 43.9 bits (102), Expect = 0.004
Identities = 32/114 (28%), Positives = 54/114 (47%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E ++ +EQE L+ ++LE E++L + E+ QE+ E QE V
Sbjct: 792 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEV 851

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
Q ++ +L E + QE E EE +E E EQ + Q+E+E
Sbjct: 852 EEQEQEQEEQELEEVEEQEQEQEEQEEQELEE---VEEQEEQELEEVEEQEEQE 902



Score = 42.4 bits (98), Expect = 0.012
Identities = 28/114 (24%), Positives = 57/114 (50%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E+E + +EQE L+ ++LE E++L + +EL+E L E ++
Sbjct: 750 QDEQEQQEEQEQQEEQEQELEEQEQELEDQEQELEEQE----QELEEQEQELEEQEQELE 805

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + ++++ LE Q QE E + E Q++ + E EQ +++E+E
Sbjct: 806 EQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQE 859



Score = 37.0 bits (84), Expect = 0.49
Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 6/106 (5%)
Frame = +1

Query: 52 EEEEDIATSKDHDEQETVLKNISEKLEAPE------RDLSAIKNSYLEELQEVNYLLTEP 213
EEEED D D ++ +K E E + LS + +E Q+ EP
Sbjct: 398 EEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEP 457

Query: 214 QENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDRE 351
Q+ L +P + + Q + + +EP Q E +P+ +E
Sbjct: 458 QQQEPLQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPLQEPQQQE 503



Score = 37.0 bits (84), Expect = 0.49
Identities = 32/140 (22%), Positives = 65/140 (46%), Gaps = 3/140 (2%)
Frame = +1

Query: 7 QEIHLADEGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQ 186
QE+ ++ L EE+E ++ +++E L+ + E+ + E +EL+
Sbjct: 830 QELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQEQEEQEE-------QELE 882

Query: 187 EVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTG 366
EV E QE + L + ++ +L E + QE + L+E Q++ + +++E V
Sbjct: 883 EV-----EEQEEQELEEVEEQEEQELEEVEEQE-QQELEEVEEQEQQGVEQQEQETVEEP 936

Query: 367 L---NRQKEEEYVITIPVVA 417
+ E+E + PVV+
Sbjct: 937 IILHGSSSEDEMEVDYPVVS 956



Score = 35.4 bits (80), Expect = 1.4
Identities = 28/138 (20%), Positives = 66/138 (47%), Gaps = 6/138 (4%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKL---EAPERDLSAIKNSYLEELQEVNYLLTEPQE 219
++E+E ++ +EQE L+ ++L E E++ + +E QE+ + + QE
Sbjct: 813 EQEQELEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQE 872

Query: 220 NRVLSQPTVAQKDKLLESQLQETEARLD---EEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ + + ++ E +L+E E + + EE + E E EQ G+ +Q++E
Sbjct: 873 QEEQEEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQELEEVEEQEQQGVEQQEQE- 931

Query: 391 YVITIPVVAGTNDADKDL 444
+ P++ + ++ ++
Sbjct: 932 -TVEEPIILHGSSSEDEM 948



Score = 35.4 bits (80), Expect = 1.4
Identities = 30/134 (22%), Positives = 61/134 (45%)
Frame = +1

Query: 37 LAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQ 216
L ++E E+ + EQE + + E+ + E + LEE++E E Q
Sbjct: 818 LEEQEQELEEQEQELEEQEQELEEQEVEEQEQEVEEQEQEQEEQELEEVEEQEQ-EQEEQ 876

Query: 217 ENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYV 396
E + L + ++ +L E + QE + + E + + + E++EQ Q+E+E V
Sbjct: 877 EEQELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQELEEVEEQEQQGV---EQQEQETV 933

Query: 397 ITIPVVAGTNDADK 438
++ G++ D+
Sbjct: 934 EEPIILHGSSSEDE 947



Score = 33.9 bits (76), Expect = 4.2
Identities = 29/140 (20%), Positives = 62/140 (44%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
++E++ +D +Q+ ++ ++ E ++D +E Q+ E Q++
Sbjct: 672 QDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDE--------QEQQDEQEQQDEQQQDEQ 723

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYVITIP 408
Q Q+D E Q Q+ + + DE+ QDE Q E +Q +++E+ +
Sbjct: 724 QQQDEQQQQD---EQQQQDEQQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQEL---- 776

Query: 409 VVAGTNDADKDLHKQAIQLE 468
D +++L +Q +LE
Sbjct: 777 -----EDQEQELEEQEQELE 791


>tr|Q8SWQ7|Q8SWQ7_LOLPE Non-muscle myosin II heavy chain OS=Loligo
pealeii PE=2 SV=1
Length = 1964

Score = 44.3 bits (103), Expect = 0.003
Identities = 38/113 (33%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
Frame = +1

Query: 55 EEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRVLS 234
+EE++ K+H E+ K E LE +L K+ E+LQ L TE +E R+L
Sbjct: 858 KEEELKKIKEHYEKT---KFEYEDLERKFANLVDEKSLLAEQLQAETELCTEAEETRILL 914

Query: 235 QPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVT-TGLNRQKEEE 390
+ LE L ETEARL+EE E +++ ++T L Q EEE
Sbjct: 915 NNRKIE----LEEVLNETEARLEEEMRNSEFLHDEKNKLRLTIEDLEEQLEEE 963


>tr|Q9LN21|Q9LN21_ARATH F14O10.11 protein OS=Arabidopsis thaliana
GN=F14O10.11 PE=4 SV=1
Length = 409

Score = 43.5 bits (101), Expect = 0.005
Identities = 28/130 (21%), Positives = 60/130 (46%)
Frame = +1

Query: 1 TSQEIHLADEGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEE 180
T +H+ + ++ A +EEEE+ ++ +E+E + E+ E E + + EE
Sbjct: 261 TPSMVHVGEGTIVQAEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 320

Query: 181 LQEVNYLLTEPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVT 360
+E E +E + ++++ E + +E E +EE ++E + E+ E+
Sbjct: 321 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 380

Query: 361 TGLNRQKEEE 390
++EEE
Sbjct: 381 EEEEEEEEEE 390



Score = 38.9 bits (89), Expect = 0.13
Identities = 25/117 (21%), Positives = 55/117 (47%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
+EEEE+ ++ +E+E + E+ E E + + EE +E E +E
Sbjct: 282 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 341

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEEYVI 399
+ ++++ E + +E E +EE ++E + E+ E+ ++E++Y+I
Sbjct: 342 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKKYMI 398



Score = 34.7 bits (78), Expect = 2.4
Identities = 23/114 (20%), Positives = 54/114 (47%)
Frame = +1

Query: 49 KEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLTEPQENRV 228
+EEEE+ ++ +E+E + E+ E E + + EE +E E +E
Sbjct: 292 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 351

Query: 229 LSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEEE 390
+ ++++ E + +E E +EE ++E + E+ E+ + ++K+++
Sbjct: 352 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKKYMIVKKKKKK 405


>tr|Q8T5C7|Q8T5C7_PLAFA Erythrocyte binding protein 1 (Chimeric
erythrocyte-binding protein MAEBL) OS=Plasmodium
falciparum GN=maebl PE=4 SV=1
Length = 2055

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/121 (21%), Positives = 63/121 (52%)
Frame = +1

Query: 28 EGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLT 207
E ++ Y+EE++ A +E+E + +K E ++ + +K EE ++ L
Sbjct: 1574 EEVMKLYEEEKKMKAEQLKKEEEEKIKAEQLKKEEEEKKKVEQLKKKEEEEKKKAEQLKK 1633

Query: 208 EPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEE 387
E +EN++ ++ + +K++ + + +E + +EE + E + E+ ++ L +++EE
Sbjct: 1634 EEEENKIKAE-QLKKKEEEEKKKAEELKKEEEEEKKKAEQLKKEEEEKKKVEQLKKKEEE 1692

Query: 388 E 390
E
Sbjct: 1693 E 1693


>tr|Q8IHP3|Q8IHP3_PLAF7 MAEBL, putative OS=Plasmodium falciparum
(isolate 3D7) GN=PF11_0486 PE=4 SV=1
Length = 2055

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/121 (21%), Positives = 63/121 (52%)
Frame = +1

Query: 28 EGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLT 207
E ++ Y+EE++ A +E+E + +K E ++ + +K EE ++ L
Sbjct: 1574 EEVMKLYEEEKKMKAEQLKKEEEEKIKAEQLKKEEEEKKKVEQLKKKEEEEKKKAEQLKK 1633

Query: 208 EPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEE 387
E +EN++ ++ + +K++ + + +E + +EE + E + E+ ++ L +++EE
Sbjct: 1634 EEEENKIKAE-QLKKKEEEEKKKAEELKKEEEEEKKKAEQLKKEEEEKKKVEQLKKKEEE 1692

Query: 388 E 390
E
Sbjct: 1693 E 1693


>tr|Q7K5Q6|Q7K5Q6_PLAFA Erythrocyte binding protein 3 OS=Plasmodium
falciparum GN=maebl PE=4 SV=1
Length = 2006

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/121 (21%), Positives = 63/121 (52%)
Frame = +1

Query: 28 EGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLT 207
E ++ Y+EE++ A +E+E + +K E ++ + +K EE ++ L
Sbjct: 1574 EEVMKLYEEEKKMKAEQLKKEEEEKIKAEQLKKEEEEKKKVEQLKKKEEEEKKKAEQLKK 1633

Query: 208 EPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEE 387
E +EN++ ++ + +K++ + + +E + +EE + E + E+ ++ L +++EE
Sbjct: 1634 EEEENKIKAE-QLKKKEEEEKKKAEELKKEEEEEKKKAEQLKKEEEEKKKVEQLKKKEEE 1692

Query: 388 E 390
E
Sbjct: 1693 E 1693


>tr|Q7K5Q5|Q7K5Q5_PLAFA Erythrocyte binding protein 2 OS=Plasmodium
falciparum GN=maebl PE=4 SV=1
Length = 2019

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/121 (21%), Positives = 63/121 (52%)
Frame = +1

Query: 28 EGLLAAYKEEEEDIATSKDHDEQETVLKNISEKLEAPERDLSAIKNSYLEELQEVNYLLT 207
E ++ Y+EE++ A +E+E + +K E ++ + +K EE ++ L
Sbjct: 1574 EEVMKLYEEEKKMKAEQLKKEEEEKIKAEQLKKEEEEKKKVEQLKKKEEEEKKKAEQLKK 1633

Query: 208 EPQENRVLSQPTVAQKDKLLESQLQETEARLDEEPHQDESCPQPEDREQVTTGLNRQKEE 387
E +EN++ ++ + +K++ + + +E + +EE + E + E+ ++ L +++EE
Sbjct: 1634 EEEENKIKAE-QLKKKEEEEKKKAEELKKEEEEEKKKAEQLKKEEEEKKKVEQLKKKEEE 1692

Query: 388 E 390
E
Sbjct: 1693 E 1693