BP915347
Clone id YMU001_000070_E01
Library
Length 291
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000070_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGTTGGAACCTTTATTCCTTGGAGAGTAAAAGGAGTGGCTGCTACAGCAATTTCTTTGTC
CACTCATTTCCTGGATGTGGGTAGGTGTAATATTTGAATAGGAAGGTTCGATTTCATACA
TGTCGAGGCATAATTTCGGAAAATTGGAAAAAATAACTCCAGTCAACAGAAGACTGGCCA
GTGCACGTCTCTTACCCTTTTAAAAGCACCCTACACTGTTACATGAGCACCCATGCCCTA
ACAAACCATACCAGAATCATGGGAACCCTCACCCTGAATATAAGCAAATGA
■■Homology search results ■■ -
sp_hit_id Q8AWW5
Definition sp|Q8AWW5|CRIM1_CHICK Cysteine-rich motor neuron 1 protein OS=Gallus gallus
Align length 45
Score (bit) 29.6
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915347|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_E01.
(291 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8AWW5|CRIM1_CHICK Cysteine-rich motor neuron 1 protein OS=Ga... 30 4.8
sp|P43984|Y318_HAEIN Uncharacterized protein HI0318 OS=Haemophil... 29 8.2
sp|A6L4U4|UXAC_BACV8 Uronate isomerase OS=Bacteroides vulgatus (... 29 8.2
sp|Q8A9J2|UXAC_BACTN Uronate isomerase OS=Bacteroides thetaiotao... 29 8.2
sp|P02863|GDA0_WHEAT Alpha/beta-gliadin OS=Triticum aestivum PE=... 29 8.2
sp|P45037|CCMF_HAEIN Cytochrome c-type biogenesis protein ccmF O... 29 8.2

>sp|Q8AWW5|CRIM1_CHICK Cysteine-rich motor neuron 1 protein
OS=Gallus gallus GN=CRIM1 PE=2 SV=1
Length = 1048

Score = 29.6 bits (65), Expect = 4.8
Identities = 15/45 (33%), Positives = 23/45 (51%)
Frame = -3

Query: 229 CSCNSVGCF*KGKRRALASLLLTGVIFSNFPKLCLDMYEIEPSYS 95
C CN GC K + ++L++ S P C D+YE +P +S
Sbjct: 222 CVCNPAGCLRKVCQPGYLNILVSKA--SGKPGECCDLYECKPVFS 264


>sp|P43984|Y318_HAEIN Uncharacterized protein HI0318 OS=Haemophilus
influenzae GN=HI0318 PE=4 SV=1
Length = 172

Score = 28.9 bits (63), Expect = 8.2
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -2

Query: 134 IMPRHV*NRTFLFKYYTYPH 75
I+P H NR+FLFKY +P+
Sbjct: 102 ILPEHQINRSFLFKYVRHPN 121


>sp|A6L4U4|UXAC_BACV8 Uronate isomerase OS=Bacteroides vulgatus
(strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=uxaC PE=3
SV=1
Length = 468

Score = 28.9 bits (63), Expect = 8.2
Identities = 13/43 (30%), Positives = 21/43 (48%)
Frame = -2

Query: 185 CTGQSSVDWSYFFQFSEIMPRHV*NRTFLFKYYTYPHPGNEWT 57
CTG+ + DW F +++E +P YT+ +P WT
Sbjct: 75 CTGKDTTDWEKFEKWAETVP------------YTFRNPLYHWT 105


>sp|Q8A9J2|UXAC_BACTN Uronate isomerase OS=Bacteroides
thetaiotaomicron GN=uxaC PE=3 SV=2
Length = 468

Score = 28.9 bits (63), Expect = 8.2
Identities = 13/43 (30%), Positives = 21/43 (48%)
Frame = -2

Query: 185 CTGQSSVDWSYFFQFSEIMPRHV*NRTFLFKYYTYPHPGNEWT 57
CTG+ + DW F +++E +P YT+ +P WT
Sbjct: 75 CTGKDTTDWEKFEKWAETVP------------YTFRNPLYHWT 105


>sp|P02863|GDA0_WHEAT Alpha/beta-gliadin OS=Triticum aestivum PE=2
SV=2
Length = 286

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/43 (34%), Positives = 21/43 (48%)
Frame = +3

Query: 159 PVNRRLASARLLPF*KHPTLLHEHPCPNKPYQNHGNPHPEYKQ 287
P +L +L PF P L + P P +P Q + P P+Y Q
Sbjct: 68 PFPSQLPYLQLQPF-PQPQLPYSQPQPFRPQQPYPQPQPQYSQ 109


>sp|P45037|CCMF_HAEIN Cytochrome c-type biogenesis protein ccmF
OS=Haemophilus influenzae GN=ccmF PE=3 SV=1
Length = 648

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
Frame = +3

Query: 24 E*KEWLLQQFLCPLISWMWVGVIFE*EGSISYM--SRHNFGKLEK 152
E W L+ + P I W+W+G +F G + M R+ F L K
Sbjct: 603 EDNSWALRLYYKPFIRWIWIGGLFMALGGLLCMFDRRYRFNVLLK 647


tr_hit_id Q2URX1
Definition tr|Q2URX1|Q2URX1_ASPOR E3 ubiquitin ligase OS=Aspergillus oryzae
Align length 62
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915347|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_E01.
(291 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2URX1|Q2URX1_ASPOR E3 ubiquitin ligase OS=Aspergillus oryzae... 35 2.4
tr|B8MXX0|B8MXX0_ASPFL RING finger protein OS=Aspergillus flavus... 35 2.4
tr|B4H120|B4H120_DROPE GL15899 OS=Drosophila persimilis GN=GL158... 33 9.3

>tr|Q2URX1|Q2URX1_ASPOR E3 ubiquitin ligase OS=Aspergillus oryzae
GN=AO090005000658 PE=4 SV=1
Length = 776

Score = 34.7 bits (78), Expect = 2.4
Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
Frame = +3

Query: 12 LFLGE*KEWLLQQFLCPLIS--WMWVGVIFE*EGSISYMSRHNFGKLEKITPVNRRLASA 185
+F GE W L F+C L+ W W+G EG + Y LE+ P N RL A
Sbjct: 93 IFRGELGGWFLVMFVCLLVGKVWGWIG-----EGRVEY--------LEQQPPANPRLFHA 139

Query: 186 RL 191
RL
Sbjct: 140 RL 141


>tr|B8MXX0|B8MXX0_ASPFL RING finger protein OS=Aspergillus flavus
NRRL3357 GN=AFLA_079070 PE=4 SV=1
Length = 776

Score = 34.7 bits (78), Expect = 2.4
Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
Frame = +3

Query: 12 LFLGE*KEWLLQQFLCPLIS--WMWVGVIFE*EGSISYMSRHNFGKLEKITPVNRRLASA 185
+F GE W L F+C L+ W W+G EG + Y LE+ P N RL A
Sbjct: 93 IFRGELGGWFLVMFVCLLVGKVWGWIG-----EGRVEY--------LEQQPPANPRLFHA 139

Query: 186 RL 191
RL
Sbjct: 140 RL 141


>tr|B4H120|B4H120_DROPE GL15899 OS=Drosophila persimilis GN=GL15899
PE=4 SV=1
Length = 464

Score = 32.7 bits (73), Expect = 9.3
Identities = 14/28 (50%), Positives = 17/28 (60%)
Frame = +3

Query: 204 KHPTLLHEHPCPNKPYQNHGNPHPEYKQ 287
KHP L H HP + Q H +PHP+ KQ
Sbjct: 7 KHPHL-HPHPQQQQQQQQHSHPHPQTKQ 33