BP915361
Clone id YMU001_000070_F04
Library
Length 454
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000070_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACGGCTCTTTAATGTGCAAGGATGCGAGACTAAGCTCTATCCTTTATCTTCTGTGGGAC
AGGAAGGCAGGTGTTTATGCTCCCAGCTCAAACAGTTCCCGCCTTTTGCAAGAGTTGTCT
TGGCAAGGTTCTGTTGGTTTTCTGTTATATATAAGAGATTTTGTGTAATTTAAAATTCTG
CTTATCAGTACAATCTTAACATTTGCTTCTATGGCTATTGTAGTTGAAAAGAGAGGGTGT
TATGAAGAAGAACTCAAACACAGGTTTAGACCTTTGCAAAAATACTTGGGCTGCAGATAC
GGCAGGCATGTCTGCAAATATGTAGCTAACTAGGTTGTAGTAGAGCAATTCTGATGATGT
AGTGAAGTCTTATTTCTACCTTTCATGCCTAAGTGTGGAGCTTGTCTTTGCCATAGACCT
ATTGCACACTTGGAGAAGGAAAATAGCAGAACCC
■■Homology search results ■■ -
sp_hit_id Q4A9N9
Definition sp|Q4A9N9|ENGB_MYCHJ Probable GTP-binding protein engB OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Align length 123
Score (bit) 35.0
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915361|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_F04.
(454 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4A9N9|ENGB_MYCHJ Probable GTP-binding protein engB OS=Mycopl... 35 0.15
sp|Q6BVF9|GAR1_DEBHA H/ACA ribonucleoprotein complex subunit 1 O... 32 0.97
sp|A3GHP2|GAR1_PICST H/ACA ribonucleoprotein complex subunit 1 O... 31 2.2
sp|A6SDR8|GAR1_BOTFB H/ACA ribonucleoprotein complex subunit 1 O... 31 2.8
sp|Q1WUG5|PYRH_LACS1 Uridylate kinase OS=Lactobacillus salivariu... 30 4.8
sp|Q923K1|TS1R3_RAT Taste receptor type 1 member 3 OS=Rattus nor... 30 6.4
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Hom... 29 8.2
sp|P07735|GPDA_DROVI Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|Q27928|GPDA_DROPS Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|P13706|GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|O97463|GPDA_DROKA Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|Q27567|GPDA_DROEZ Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|Q27556|GPDA_DROAE Glycerol-3-phosphate dehydrogenase [NAD+], ... 29 8.4
sp|Q5U7M9|SEMG2_MACNE Semenogelin-2 OS=Macaca nemestrina GN=SEMG... 27 8.8
sp|Q5U7N1|SEMG2_HYLLA Semenogelin-2 OS=Hylobates lar GN=SEMG2 PE... 27 8.8
sp|Q6X2M3|SEMG2_HYLKL Semenogelin-2 OS=Hylobates klossii GN=SEMG... 27 8.9
sp|Q5U7N3|SEMG2_GORGO Semenogelin-2 OS=Gorilla gorilla gorilla G... 27 9.0
sp|Q5U7N4|SEMG2_PANTR Semenogelin-2 OS=Pan troglodytes GN=SEMG2 ... 27 9.1

>sp|Q4A9N9|ENGB_MYCHJ Probable GTP-binding protein engB
OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 /
NCTC 10110) GN=engB PE=3 SV=2
Length = 198

Score = 35.0 bits (79), Expect = 0.15
Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 6/123 (4%)
Frame = -2

Query: 453 GSAIFLLQVCNRSMAKTSSTLRHER*K*DFTTSSELLYYNLVSYIFADMPAVSAAQV--- 283
G + + + N+ +AKTS+ + + SE L+ +L Y +A + Q+
Sbjct: 49 GKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKDQIDRI 108

Query: 282 ---FLQRSKPVFEFFFITPSLFNYNSHRSKC*DCTDKQNFKLHKISYI*QKTNRTLPRQL 112
+ Q+ +P+ F I + + + + KQ FKLH ++ KTN++ L
Sbjct: 109 IAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIKQGFKLHILANKIDKTNQSTRAIL 168

Query: 111 LQK 103
L +
Sbjct: 169 LNQ 171


>sp|Q6BVF9|GAR1_DEBHA H/ACA ribonucleoprotein complex subunit 1
OS=Debaryomyces hansenii GN=GAR1 PE=3 SV=1
Length = 215

Score = 32.3 bits (72), Expect = 0.97
Identities = 18/66 (27%), Positives = 32/66 (48%)
Frame = -3

Query: 278 CKGLNLCLSSSS*HPLFSTTIAIEANVKIVLISRILNYTKSLIYNRKPTEPCQDNSCKRR 99
C+G +C S + P F+ I +E ++ + IL + + KP+E Q +S K
Sbjct: 39 CEGDIVCRSINVKIPYFNAPIYLENKTQVGKVDEILGPVNEVFFTIKPSEGVQADSFKDG 98

Query: 98 ELFELG 81
+ F +G
Sbjct: 99 DKFYIG 104


>sp|A3GHP2|GAR1_PICST H/ACA ribonucleoprotein complex subunit 1
OS=Pichia stipitis GN=GAR1 PE=3 SV=1
Length = 202

Score = 31.2 bits (69), Expect = 2.2
Identities = 18/66 (27%), Positives = 32/66 (48%)
Frame = -3

Query: 278 CKGLNLCLSSSS*HPLFSTTIAIEANVKIVLISRILNYTKSLIYNRKPTEPCQDNSCKRR 99
C+G +C S + P F+ I +E +I + IL + + KP+E + +S K
Sbjct: 39 CEGDIVCRSINVKIPYFNAPIYLENKTQIGKVDEILGPLNEVFFTIKPSEGVKADSFKEG 98

Query: 98 ELFELG 81
+ F +G
Sbjct: 99 DKFFIG 104


>sp|A6SDR8|GAR1_BOTFB H/ACA ribonucleoprotein complex subunit 1
OS=Botryotinia fuckeliana (strain B05.10) GN=GAR1 PE=3
SV=1
Length = 221

Score = 30.8 bits (68), Expect = 2.8
Identities = 19/65 (29%), Positives = 30/65 (46%)
Frame = -3

Query: 275 KGLNLCLSSSS*HPLFSTTIAIEANVKIVLISRILNYTKSLIYNRKPTEPCQDNSCKRRE 96
+G +C S ++ P F+ I +E I + IL + + KPTE Q S K +
Sbjct: 58 EGEIVCESINTKIPYFNAPIYLENKTSIGKVDEILGPINQVYFTIKPTEGIQATSFKTGD 117

Query: 95 LFELG 81
F +G
Sbjct: 118 KFYIG 122


>sp|Q1WUG5|PYRH_LACS1 Uridylate kinase OS=Lactobacillus salivarius
subsp. salivarius (strain UCC118) GN=pyrH PE=3 SV=1
Length = 240

Score = 30.0 bits (66), Expect = 4.8
Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 15/97 (15%)
Frame = -3

Query: 422 IGLWQRQAPHLGMKGRNKTSLHHQNCSTTT*LATYLQTCL-------PYLQPK---YFCK 273
IG+ + QA ++GM G +L Q+ + + T +QT + PY++ K + K
Sbjct: 66 IGMERAQADYIGMLGTVMNALALQDSLESVGVPTRVQTAIEMRQVAEPYIRRKAIRHLEK 125

Query: 272 GLNLCLSSSS*HPLFSTTI-----AIEANVKIVLISR 177
G + ++ + P FST A E N +++L+++
Sbjct: 126 GRIVIFAAGTGSPYFSTDTTAALRASELNAEVILMAK 162


>sp|Q923K1|TS1R3_RAT Taste receptor type 1 member 3 OS=Rattus
norvegicus GN=Tas1r3 PE=2 SV=1
Length = 858

Score = 29.6 bits (65), Expect = 6.4
Identities = 11/25 (44%), Positives = 15/25 (60%)
Frame = +1

Query: 358 CSEVLFLPFMPKCGACLCHRPIAHL 432
C VL P P+ +CL +P+AHL
Sbjct: 623 CLSVLLFPGRPRSASCLAQQPMAHL 647


>sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo
sapiens GN=PI4KA PE=1 SV=3
Length = 2044

Score = 29.3 bits (64), Expect = 8.2
Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
Frame = -3

Query: 311 TCLP---YLQPKYFCKGLNLCLSSSS*HPLFSTTIAIEANVKIVLISRILNYTKSLI 150
+CLP L+P+Y+ ++ SS S PLF+ E N+ + ++ +LN K ++
Sbjct: 229 SCLPDGTALEPEYYFSTIS---SSFSVSPLFNGVTYKEFNIPLEMLRELLNLVKKIV 282


>sp|P07735|GPDA_DROVI Glycerol-3-phosphate dehydrogenase [NAD+],
cytoplasmic OS=Drosophila virilis GN=Gpdh PE=1 SV=3
Length = 353

Score = 29.3 bits (64), Expect = 8.4
Identities = 10/20 (50%), Positives = 15/20 (75%)
Frame = +2

Query: 71 VFMLPAQTVPAFCKSCLGKV 130
+F++P Q +P FCK LGK+
Sbjct: 91 IFVVPHQFIPNFCKQLLGKI 110


>sp|Q27928|GPDA_DROPS Glycerol-3-phosphate dehydrogenase [NAD+],
cytoplasmic OS=Drosophila pseudoobscura pseudoobscura
GN=Gpdh PE=3 SV=2
Length = 360

Score = 29.3 bits (64), Expect = 8.4
Identities = 10/20 (50%), Positives = 15/20 (75%)
Frame = +2

Query: 71 VFMLPAQTVPAFCKSCLGKV 130
+F++P Q +P FCK LGK+
Sbjct: 91 IFVVPHQFIPNFCKQLLGKI 110


>sp|P13706|GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD+],
cytoplasmic OS=Drosophila melanogaster GN=Gpdh PE=1 SV=3
Length = 363

Score = 29.3 bits (64), Expect = 8.4
Identities = 10/20 (50%), Positives = 15/20 (75%)
Frame = +2

Query: 71 VFMLPAQTVPAFCKSCLGKV 130
+F++P Q +P FCK LGK+
Sbjct: 91 IFVVPHQFIPNFCKQLLGKI 110


tr_hit_id B4K7X6
Definition tr|B4K7X6|B4K7X6_DROMO GI23407 OS=Drosophila mojavensis
Align length 116
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915361|Adiantum capillus-veneris mRNA, clone:
YMU001_000070_F04.
(454 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4K7X6|B4K7X6_DROMO GI23407 OS=Drosophila mojavensis GN=GI234... 33 5.4

>tr|B4K7X6|B4K7X6_DROMO GI23407 OS=Drosophila mojavensis GN=GI23407
PE=4 SV=1
Length = 514

Score = 33.5 bits (75), Expect = 5.4
Identities = 32/116 (27%), Positives = 45/116 (38%), Gaps = 2/116 (1%)
Frame = +1

Query: 64 KAGVYAPSSNSSRLLQELSWQGSVGFLLY--IRDFV*FKILLISTILTFASMAIVVEKRG 237
+AG P S + + W ++ + LY +FV ++I T M V KRG
Sbjct: 264 RAGTQVPFSMHLMIKESNQWSNNMNYHLYENTENFVSIDPMVIQTSKNTEVMDPV--KRG 321

Query: 238 CYEEELKHRFRPLQKYLGCRYGRHVCKYVAN*VVVEQF**CSEVLFLPFMPKCGAC 405
CY E +H P Y Y R C + V CS L+LP + C
Sbjct: 322 CYFEHERH---PDYPYRDLPYSRSNCIFTCLQWTVIDACNCSMPLYLPDIDDTREC 374