BP915394
Clone id YMU001_000071_A09
Library
Length 592
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCGCGGCCGCGAATCCGACTCAAGACTTGGGTCCACTGGAGGCGATGTCCACCCCGGG
TGGGAGCCCACCTGAGATGTGAACCAACCAAAAGAAGAGCCAGCTGGCTGCTCCTCACCA
GTCAGTCTGTCGTCAGACATCTACATTACAGAGAGCAATATAAGATTAAGCTTTCCACCC
TACTCACTAATCTAAATATACATACACAAGTATATTACCACACAAACACATAGATGCATA
TACATACTAGTAGACCTAAGTAGAGGCTAGTAGTGCCAAAGGTCGACTACACCTCTTTAG
ATATCATCGCAGTCTCAACCGTGGTAAAACCAAAGGTACGTTGCGGTAATCCATGCATGA
GTGGATCAATGACCGCAACGCCACGATTAAAAAAGGACTATACCCAAGAGGAAGCGTCTA
ACCTTCGGATGCTATGCTCCCGTACTTATATGTGTTAAGGTTGTAAATGTAGCCATCATT
TTGTGATGGCTGCACCTAAATTCAACATCTAAGTGCTCAATTGATCGTAACATTACAATT
CTAATGTAATGCAATAAGTAATTCTATTTCTCTCACTCTATCTCTCTCTCTC
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915394|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_A09.
(576 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A8IGM5
Definition tr|A8IGM5|A8IGM5_CHLRE Predicted protein (Fragment) OS=Chlamydomonas reinhardtii
Align length 76
Score (bit) 36.2
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915394|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_A09.
(576 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8IGM5|A8IGM5_CHLRE Predicted protein (Fragment) OS=Chlamydom... 36 1.3
tr|A9V6I7|A9V6I7_MONBE Predicted protein OS=Monosiga brevicollis... 35 2.3
tr|Q0UTH2|Q0UTH2_PHANO Putative uncharacterized protein OS=Phaeo... 34 6.5
tr|Q4T1Z6|Q4T1Z6_TETNG Chromosome undetermined SCAF10407, whole ... 33 8.6

>tr|A8IGM5|A8IGM5_CHLRE Predicted protein (Fragment)
OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_127918 PE=4
SV=1
Length = 693

Score = 36.2 bits (82), Expect = 1.3
Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 3/76 (3%)
Frame = -1

Query: 261 GTTSLYLGLLVCICIYVFVW*YTCVCIFRLVS-RVESLILYCSL*CRCLTTD*LVRSSQL 85
GTT+ L L V + +YV++W + CVC+ V V + C C CL L R+ L
Sbjct: 496 GTTAENLALQVRVAVYVWLWLWLCVCVCVCVCVCVCVCVCVCVCLCLCLCPK-LERTPAL 554

Query: 84 ALLL--VGSHLRWAPT 43
+ + + S L+WA T
Sbjct: 555 CVCVCDLRSFLQWAAT 570


>tr|A9V6I7|A9V6I7_MONBE Predicted protein OS=Monosiga brevicollis
GN=33676 PE=4 SV=1
Length = 827

Score = 35.4 bits (80), Expect = 2.3
Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = -1

Query: 249 LYLGLLVCICIYVFVW*YTCVCIFRLVSRVESL--ILYCSL*CRCLTTD*LVRSSQLALL 76
L L L VC+C+ V V CVC+F + +L + C C CL+ L R + L L
Sbjct: 110 LPLPLCVCVCVCVCVCVCVCVCVFLRLCLCVALASVCLCLCLCLCLSACLLTRCASLCAL 169

Query: 75 LV 70
V
Sbjct: 170 TV 171


>tr|Q0UTH2|Q0UTH2_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_04942 PE=4 SV=2
Length = 595

Score = 33.9 bits (76), Expect = 6.5
Identities = 18/64 (28%), Positives = 31/64 (48%)
Frame = +2

Query: 23 WRRCPPRVGAHLRCEPTKRRASWLLLTSQSVVRHLHYREQYKIKLSTLLTNLNIHTQVYY 202
W + P+ L E + +A L + RHL YR Y+ ++ + N+NI+ +
Sbjct: 387 WLQLKPK----LEKEAAELKAKGGLQEERPAARHLRYRSHYRGNINNININININININT 442

Query: 203 HTNT 214
+TNT
Sbjct: 443 NTNT 446


>tr|Q4T1Z6|Q4T1Z6_TETNG Chromosome undetermined SCAF10407, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00008571001 PE=4 SV=1
Length = 2059

Score = 33.5 bits (75), Expect = 8.6
Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 14/51 (27%)
Frame = +2

Query: 122 HLHYREQYK--------------IKLSTLLTNLNIHTQVYYHTNT*MHIHT 232
HLH R+Q + IK S+L+T+ + HT + HT+T H HT
Sbjct: 1076 HLHLRQQKELLICSGILSSIFSIIKTSSLVTHTHTHTHTHTHTHTHTHTHT 1126