BP915433
Clone id YMU001_000071_E04
Library
Length 582
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCCAGGTGATTAAGAAGTGGTCCCAATACACGATGGCTATGAATGGGCATGTGAGAAGT
GCATCCTCACAGCAAAGGAGGCAAGGCCTTCTAAAGGATCAATTGAGATTAGTCAAGAGG
AGGGATTGTGATCGTTTTGAAATCGAGCGAGTGCCAGACCCTTTATCCTTTGACAAGGGA
ATTTTTCTTTTTATCCGAGCATGTCAACTTTTGTCACAAAAAATAAAAGGGGTGATTTTA
GTTGGGCTGGCAGGGCCATCAGGTGCAGGCAAAACCGTATTTTCAGAGAAGGTTAACAAA
TTTATGCCAGGCATTACTGTAATTTCAATGGACAATTATAATGATGGCACCCGTATTGTT
GACGGGAATTATGATGACCCAAGACTTACCGATTATGACTTGCTCCTGAAAAACATTAGT
GATCTGAAAGCTGGCATTCCTGTGGAAGTCCCTATTTACGACTTCAAATTGAGTTGCCGT
ACAGGATTCAGGAAGGTCGAAGTTCCCACTTCTCGAATTGTAATTATTGAGGGCATTTAT
GCTCTGAGCGAGAAGCTGCGGCCTCTTCTTGATCTTCCTGAA
■■Homology search results ■■ -
sp_hit_id P67412
Definition sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (strain MW2)
Align length 127
Score (bit) 75.1
E-value 2.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915433|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_E04.
(582 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|A8Z4E9|URK_STAAT Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q6G8V8|URK_STAAS Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q6GG92|URK_STAAR Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|P67411|URK_STAAN Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|P67410|URK_STAAM Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|A6QHF2|URK_STAAE Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q5HFF1|URK_STAAC Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q2YT67|URK_STAAB Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|A5ITD6|URK_STAA9 Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q2FXW6|URK_STAA8 Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q2FGB5|URK_STAA3 Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|A6U280|URK_STAA2 Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|A7X320|URK_STAA1 Uridine kinase OS=Staphylococcus aureus (str... 75 2e-13
sp|Q49Y49|URK_STAS1 Uridine kinase OS=Staphylococcus saprophytic... 73 1e-12
sp|A5VKU8|URK_LACRD Uridine kinase OS=Lactobacillus reuteri (str... 72 2e-12
sp|Q662Z7|URK_BORGA Uridine kinase OS=Borrelia garinii GN=udk PE... 72 2e-12
sp|Q59190|URK_BORBU Uridine kinase OS=Borrelia burgdorferi GN=ud... 72 2e-12
sp|Q4L6V8|URK_STAHJ Uridine kinase OS=Staphylococcus haemolyticu... 72 3e-12
sp|Q0SPE9|URK_BORAP Uridine kinase OS=Borrelia afzelii (strain P... 72 3e-12
sp|Q8CSB2|URK_STAES Uridine kinase OS=Staphylococcus epidermidis... 71 3e-12
sp|Q5HNT9|URK_STAEQ Uridine kinase OS=Staphylococcus epidermidis... 71 3e-12
sp|O32033|URK_BACSU Uridine kinase OS=Bacillus subtilis GN=udk P... 71 4e-12
sp|A2RDZ9|URK_STRPG Uridine kinase OS=Streptococcus pyogenes ser... 70 8e-12
sp|Q5XBI8|URK_STRP6 Uridine kinase OS=Streptococcus pyogenes ser... 70 8e-12
sp|P67416|URK_STRP3 Uridine kinase OS=Streptococcus pyogenes ser... 70 8e-12
sp|P67415|URK_STRP1 Uridine kinase OS=Streptococcus pyogenes ser... 70 8e-12
sp|Q896E3|URK_CLOTE Uridine kinase OS=Clostridium tetani GN=udk ... 70 1e-11
sp|Q65GT3|URK_BACLD Uridine kinase OS=Bacillus licheniformis (st... 70 1e-11
sp|Q8P0F8|URK_STRP8 Uridine kinase OS=Streptococcus pyogenes ser... 69 1e-11

>sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (strain
MW2) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|A8Z4E9|URK_STAAT Uridine kinase OS=Staphylococcus aureus (strain
USA300 / TCH1516) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|Q6G8V8|URK_STAAS Uridine kinase OS=Staphylococcus aureus (strain
MSSA476) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|Q6GG92|URK_STAAR Uridine kinase OS=Staphylococcus aureus (strain
MRSA252) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|P67411|URK_STAAN Uridine kinase OS=Staphylococcus aureus (strain
N315) GN=udk PE=1 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|P67410|URK_STAAM Uridine kinase OS=Staphylococcus aureus (strain
Mu50 / ATCC 700699) GN=udk PE=1 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|A6QHF2|URK_STAAE Uridine kinase OS=Staphylococcus aureus (strain
Newman) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|Q5HFF1|URK_STAAC Uridine kinase OS=Staphylococcus aureus (strain
COL) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|Q2YT67|URK_STAAB Uridine kinase OS=Staphylococcus aureus (strain
bovine RF122 / ET3-1) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


>sp|A5ITD6|URK_STAA9 Uridine kinase OS=Staphylococcus aureus (strain
JH9) GN=udk PE=3 SV=1
Length = 207

Score = 75.1 bits (183), Expect = 2e-13
Identities = 43/127 (33%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
Frame = +1

Query: 223 IKGVILVGLAGPSGAGKTVFSEKVNKFMPG--ITVISMDNYNDGTRIV------DGNYDD 378
+K ++G+AG SG+GKT + ++ K + G + +++ D Y + + + NYD
Sbjct: 1 MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDH 60

Query: 379 PRLTDYDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEK- 555
P D DLL++N+ DLK G VEVP YD+ R+ ++ ++I+EGI+AL K
Sbjct: 61 PFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDI-TIDFKPKDVIIVEGIFALENKV 119

Query: 556 LRPLLDL 576
LR ++D+
Sbjct: 120 LRDMMDV 126


tr_hit_id A7WPK7
Definition tr|A7WPK7|A7WPK7_TOBAC Putative uncharacterized protein C365 OS=Nicotiana tabacum
Align length 173
Score (bit) 260.0
E-value 3.0e-68
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915433|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_E04.
(582 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7WPK7|A7WPK7_TOBAC Putative uncharacterized protein C365 OS=... 260 3e-68
tr|Q8S3R9|Q8S3R9_ORYSJ Putative uridine kinase (Putative unchara... 256 8e-67
tr|Q6YV21|Q6YV21_ORYSJ Os02g0708200 protein OS=Oryza sativa subs... 256 8e-67
tr|B8AHA3|B8AHA3_ORYSI Putative uncharacterized protein OS=Oryza... 256 8e-67
tr|A7PND2|A7PND2_VITVI Chromosome chr1 scaffold_22, whole genome... 250 5e-65
tr|Q9C9B9|Q9C9B9_ARATH Putative uncharacterized protein F2P9.15 ... 249 1e-64
tr|Q9C664|Q9C664_ARATH Putative uncharacterized protein F28B23.1... 248 2e-64
tr|A7PGI4|A7PGI4_VITVI Chromosome chr17 scaffold_16, whole genom... 241 3e-62
tr|A4S7U4|A4S7U4_OSTLU Predicted protein (Fragment) OS=Ostreococ... 191 3e-47
tr|Q00UW5|Q00UW5_OSTTA Armadillo/beta-Catenin/plakoglobin (ISS) ... 178 2e-43
tr|A8IW58|A8IW58_CHLRE Predicted protein (Fragment) OS=Chlamydom... 166 1e-39
tr|Q54R62|Q54R62_DICDI Uridine kinase OS=Dictyostelium discoideu... 154 5e-36
tr|Q9GNF0|Q9GNF0_DICDI Uridine kinase-like protein (Putative unc... 112 2e-23
tr|A7P3M6|A7P3M6_VITVI Chromosome chr1 scaffold_5, whole genome ... 109 1e-22
tr|B8AS01|B8AS01_ORYSI Putative uncharacterized protein OS=Oryza... 102 2e-20
tr|A5BL07|A5BL07_VITVI Putative uncharacterized protein OS=Vitis... 98 4e-19
tr|A9TVB0|A9TVB0_PHYPA Predicted protein (Fragment) OS=Physcomit... 97 5e-19
tr|Q7XLI1|Q7XLI1_ORYSA OSJNBa0079F16.16 protein OS=Oryza sativa ... 95 3e-18
tr|A3ARW7|A3ARW7_ORYSJ Putative uncharacterized protein OS=Oryza... 94 4e-18
tr|Q0JEG1|Q0JEG1_ORYSJ Os04g0280200 protein OS=Oryza sativa subs... 92 2e-17
tr|Q9ZVF8|Q9ZVF8_ARATH Putative uncharacterized protein At2g0146... 85 3e-15
tr|A7B3L6|A7B3L6_RUMGN Putative uncharacterized protein OS=Rumin... 74 8e-12
tr|Q03G87|Q03G87_PEDPA Uridine kinase OS=Pediococcus pentosaceus... 73 1e-11
tr|Q6F1G0|Q6F1G0_MESFL Uridine kinase OS=Mesoplasma florum GN=Mf... 73 1e-11
tr|B3XMQ3|B3XMQ3_LACRE Uridine kinase OS=Lactobacillus reuteri 1... 73 1e-11
tr|B2G882|B2G882_LACRJ Uridine kinase OS=Lactobacillus reuteri (... 72 2e-11
tr|Q1IM45|Q1IM45_ACIBL Uridine kinase OS=Acidobacteria bacterium... 72 2e-11
tr|B7XUQ8|B7XUQ8_BORGA Uridine kinase OS=Borrelia garinii Far04 ... 72 2e-11
tr|B7XTA6|B7XTA6_BORGA Uridine kinase OS=Borrelia garinii PBr GN... 72 2e-11
tr|B7J0V4|B7J0V4_BORBU Uridine kinase OS=Borrelia burgdorferi ZS... 72 2e-11

>tr|A7WPK7|A7WPK7_TOBAC Putative uncharacterized protein C365
OS=Nicotiana tabacum GN=C365 PE=2 SV=1
Length = 661

Score = 260 bits (665), Expect = 3e-68
Identities = 127/173 (73%), Positives = 149/173 (86%)
Frame = +1

Query: 58 SASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVI 237
+A S RR GLLKDQ+RLVKR++CDR+EI +PD LSF+KG F+ IRACQLL QK +G+I
Sbjct: 7 NAESNHRRAGLLKDQVRLVKRKNCDRYEIVSIPDNLSFEKGFFVVIRACQLLVQKNEGLI 66

Query: 238 LVGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNI 417
+VG+AGPSGAGKTVF+EK+ FMP + VISMDNYND +RIVDGN+DDPRLTDYD LLKNI
Sbjct: 67 IVGVAGPSGAGKTVFTEKILSFMPSVAVISMDNYNDASRIVDGNFDDPRLTDYDTLLKNI 126

Query: 418 SDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
+DLKAG EVPIYDFK S R G+R +EVP+SRI+IIEGIYALSEKLRPLLDL
Sbjct: 127 NDLKAGKQAEVPIYDFKSSSRVGYRTLEVPSSRILIIEGIYALSEKLRPLLDL 179


>tr|Q8S3R9|Q8S3R9_ORYSJ Putative uridine kinase (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=49D11.13 PE=4 SV=1
Length = 646

Score = 256 bits (653), Expect = 8e-67
Identities = 125/172 (72%), Positives = 148/172 (86%)
Frame = +1

Query: 61 ASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVIL 240
A S +RR GLL+DQ++LVKR+D +R+EI R PDPLSF+KG F+ IRACQLL Q +G+I
Sbjct: 2 ADSPRRRNGLLRDQVQLVKRKDTNRYEIVRFPDPLSFEKGFFVMIRACQLLVQHNEGMIF 61

Query: 241 VGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNIS 420
VG+AGPSGAGKTVF+EKV FMPG+ VISMDNYND +RIVDGN+DDPRLTDYD LL+NI
Sbjct: 62 VGVAGPSGAGKTVFTEKVLNFMPGVAVISMDNYNDASRIVDGNFDDPRLTDYDTLLENIH 121

Query: 421 DLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
LK G V+VPIYDFK+SCRTG+R V+VP+SRIVIIEGIYALSEKLR +LDL
Sbjct: 122 GLKEGRSVQVPIYDFKMSCRTGYRTVDVPSSRIVIIEGIYALSEKLRSVLDL 173


>tr|Q6YV21|Q6YV21_ORYSJ Os02g0708200 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0060O16.26 PE=2 SV=1
Length = 652

Score = 256 bits (653), Expect = 8e-67
Identities = 125/172 (72%), Positives = 148/172 (86%)
Frame = +1

Query: 61 ASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVIL 240
A S +RR GLL+DQ++LVKR+D +R+EI R PDPLSF+KG F+ IRACQLL Q +G+I
Sbjct: 8 ADSPRRRNGLLRDQVQLVKRKDTNRYEIVRFPDPLSFEKGFFVMIRACQLLVQHNEGMIF 67

Query: 241 VGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNIS 420
VG+AGPSGAGKTVF+EKV FMPG+ VISMDNYND +RIVDGN+DDPRLTDYD LL+NI
Sbjct: 68 VGVAGPSGAGKTVFTEKVLNFMPGVAVISMDNYNDASRIVDGNFDDPRLTDYDTLLENIH 127

Query: 421 DLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
LK G V+VPIYDFK+SCRTG+R V+VP+SRIVIIEGIYALSEKLR +LDL
Sbjct: 128 GLKEGRSVQVPIYDFKMSCRTGYRTVDVPSSRIVIIEGIYALSEKLRSVLDL 179


>tr|B8AHA3|B8AHA3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08637 PE=4 SV=1
Length = 647

Score = 256 bits (653), Expect = 8e-67
Identities = 125/172 (72%), Positives = 148/172 (86%)
Frame = +1

Query: 61 ASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVIL 240
A S +RR GLL+DQ++LVKR+D +R+EI R PDPLSF+KG F+ IRACQLL Q +G+I
Sbjct: 2 ADSPRRRNGLLRDQVQLVKRKDTNRYEIVRFPDPLSFEKGFFVMIRACQLLVQHNEGMIF 61

Query: 241 VGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNIS 420
VG+AGPSGAGKTVF+EKV FMPG+ VISMDNYND +RIVDGN+DDPRLTDYD LL+NI
Sbjct: 62 VGVAGPSGAGKTVFTEKVLNFMPGVAVISMDNYNDASRIVDGNFDDPRLTDYDTLLENIH 121

Query: 421 DLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
LK G V+VPIYDFK+SCRTG+R V+VP+SRIVIIEGIYALSEKLR +LDL
Sbjct: 122 GLKEGRSVQVPIYDFKMSCRTGYRTVDVPSSRIVIIEGIYALSEKLRSVLDL 173


>tr|A7PND2|A7PND2_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021201001
PE=4 SV=1
Length = 663

Score = 250 bits (638), Expect = 5e-65
Identities = 123/172 (71%), Positives = 146/172 (84%)
Frame = +1

Query: 61 ASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVIL 240
A S Q R GLLKDQ+RLV+R++ DR+EI + D LSF+KG F+ IRACQLL+Q G+IL
Sbjct: 8 AESPQPRPGLLKDQVRLVRRKNSDRYEIVPIQDRLSFEKGFFIVIRACQLLAQNNDGIIL 67

Query: 241 VGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNIS 420
VGLAGPSGAGKTVF+EK+ FMP I VISMDNYND +RIVDGN+DDPRLTDYD LL+N+
Sbjct: 68 VGLAGPSGAGKTVFTEKILNFMPSIAVISMDNYNDASRIVDGNFDDPRLTDYDTLLQNVH 127

Query: 421 DLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
DLKAG V++PIYDFK S RTG+R +EVP+SRIVIIEGI+ALSEK+RPLLDL
Sbjct: 128 DLKAGKQVQIPIYDFKSSSRTGYRTLEVPSSRIVIIEGIHALSEKMRPLLDL 179


>tr|Q9C9B9|Q9C9B9_ARATH Putative uncharacterized protein F2P9.15
(At1g73980/F2P9_15) OS=Arabidopsis thaliana GN=At1g73980
PE=2 SV=1
Length = 643

Score = 249 bits (635), Expect = 1e-64
Identities = 122/181 (67%), Positives = 150/181 (82%)
Frame = +1

Query: 34 MAMNGHVRSASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLL 213
MA++ V A S +RR GLL+DQ++L+KR+D R+EI + DPLSF+KG + IRACQLL
Sbjct: 1 MALDSSV--ALSPRRRHGLLRDQVQLIKRKDSGRYEIVPIEDPLSFEKGFYAVIRACQLL 58

Query: 214 SQKIKGVILVGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTD 393
+QK G+ILVGLAGPSGAGKT+F+EK+ FMP I +I+MDNYNDGTR++DGN+DDPRLTD
Sbjct: 59 AQKNDGLILVGLAGPSGAGKTIFTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTD 118

Query: 394 YDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLD 573
YD LL NI L+ G PV+VPIYDFK S R G+R +EVP+SRIVI+EGIYALSEKLRPLLD
Sbjct: 119 YDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRIVILEGIYALSEKLRPLLD 178

Query: 574 L 576
L
Sbjct: 179 L 179


>tr|Q9C664|Q9C664_ARATH Putative uncharacterized protein F28B23.13
(Putative uncharacterized protein At1g26190)
OS=Arabidopsis thaliana GN=At1g26190 PE=2 SV=1
Length = 674

Score = 248 bits (633), Expect = 2e-64
Identities = 123/168 (73%), Positives = 141/168 (83%)
Frame = +1

Query: 73 QRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVILVGLA 252
Q+R GLLKDQ++LVKRRD R+EI + D LSF+KG F IRACQLLSQK G+ILVG+A
Sbjct: 12 QKRHGLLKDQVQLVKRRDSIRYEIVSIQDRLSFEKGFFAVIRACQLLSQKNDGIILVGVA 71

Query: 253 GPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNISDLKA 432
GPSGAGKTVF+EK+ F+P + VISMDNYND +RIVDGN+DDPRLTDYD LLKN+ DLK
Sbjct: 72 GPSGAGKTVFTEKILNFLPSVAVISMDNYNDSSRIVDGNFDDPRLTDYDTLLKNLEDLKE 131

Query: 433 GIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
G VEVPIYDFK S R G+R ++VP SRIVIIEGIYALSEKLRPLLDL
Sbjct: 132 GKQVEVPIYDFKSSSRVGYRTLDVPPSRIVIIEGIYALSEKLRPLLDL 179


>tr|A7PGI4|A7PGI4_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017571001
PE=4 SV=1
Length = 661

Score = 241 bits (614), Expect = 3e-62
Identities = 119/172 (69%), Positives = 143/172 (83%)
Frame = +1

Query: 61 ASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKGVIL 240
A S +R+ GLL+DQ++LVKR+D R+EI + + LSF+KG F+ IRACQLL+Q G+IL
Sbjct: 9 ADSPRRKSGLLRDQVQLVKRKDSTRYEIVPIQNSLSFEKGFFIVIRACQLLAQNNDGIIL 68

Query: 241 VGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLKNIS 420
VG+AGPSGAGKTV +EKV FMP I VISMDNYND +RI+DGN+DDPRLTDY LL+NI
Sbjct: 69 VGVAGPSGAGKTVLTEKVLNFMPSIAVISMDNYNDSSRIIDGNFDDPRLTDYGTLLENIH 128

Query: 421 DLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
LKAG PV+VPIYDFK S R G+R V+VP+SRIVIIEGIYALSE+LRPLLDL
Sbjct: 129 GLKAGKPVQVPIYDFKSSSRIGYRTVDVPSSRIVIIEGIYALSERLRPLLDL 180


>tr|A4S7U4|A4S7U4_OSTLU Predicted protein (Fragment) OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_43015 PE=3 SV=1
Length = 526

Score = 191 bits (484), Expect = 3e-47
Identities = 100/181 (55%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
Frame = +1

Query: 46 GHVRSASSQQRRQGLLKDQLRLVKRRDCD---RFEIERVPDPLSFDKGIFLFIRACQLLS 216
GH S GL+KD LRLV ++ D R EI RV + LSFDKG +L IRA QLL
Sbjct: 58 GHGTRVGSPGGGSGLIKDALRLVTKKTRDGATRAEIARVDEQLSFDKGFYLTIRAIQLLK 117

Query: 217 QKI-KGVILVGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTD 393
+ I+VG+AGPSGAGKTVF+ K+ +FMPG +SMD YND + +++GN+DDPRLTD
Sbjct: 118 ASAPERTIVVGVAGPSGAGKTVFTSKIQEFMPGAVTLSMDMYNDSSMLLEGNFDDPRLTD 177

Query: 394 YDLLLKNISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLD 573
Y LL+N+ LK G VE P+YD+K S RTG+ V P S++VI+EGIYAL+EKLRP+LD
Sbjct: 178 YACLLENLKGLKNGETVETPVYDYKESKRTGYVTVPCPASKVVILEGIYALNEKLRPMLD 237

Query: 574 L 576
L
Sbjct: 238 L 238


>tr|Q00UW5|Q00UW5_OSTTA Armadillo/beta-Catenin/plakoglobin (ISS)
(Fragment) OS=Ostreococcus tauri GN=Ot15g02430 PE=4 SV=1
Length = 744

Score = 178 bits (451), Expect = 2e-43
Identities = 92/175 (52%), Positives = 123/175 (70%), Gaps = 1/175 (0%)
Frame = +1

Query: 55 RSASSQQRRQGLLKDQLRLVKRRDCDRFEIERVPDPLSFDKGIFLFIRACQLLSQKIKG- 231
R A + + + +D+ + K R EI RV + LSFDKG +L IRA QLL +
Sbjct: 97 RDARADGGGESVERDERKTTKEGG-KRVEIARVEEQLSFDKGFYLTIRAIQLLKMGMPDR 155

Query: 232 VILVGLAGPSGAGKTVFSEKVNKFMPGITVISMDNYNDGTRIVDGNYDDPRLTDYDLLLK 411
I+VG+AGPSGAGKTVF+ K+ +FMPG +SMD YND + +++GN+DDPRLTDY LL
Sbjct: 156 TIVVGVAGPSGAGKTVFTSKIQEFMPGAVTLSMDMYNDASMLLEGNFDDPRLTDYSCLLD 215

Query: 412 NISDLKAGIPVEVPIYDFKLSCRTGFRKVEVPTSRIVIIEGIYALSEKLRPLLDL 576
N+ LK G V+VP+YDFK S RTG+ V PT+++VI+EGIYAL+EKLRP++DL
Sbjct: 216 NLRGLKNGEAVQVPVYDFKESKRTGYVTVPNPTAKVVILEGIYALNEKLRPMIDL 270