BP915446
Clone id YMU001_000071_F06
Library
Length 343
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCGAGGACGAGTGACGCGATGACCTGCTTTTGGGGCTGGGTAAAGGCTCCTCTGCCACT
TCGTGCCTGCTAAAACCGCAGCCCATGTCTCTACCTTCTTCATGAGCCAAGAATGCAGAT
TCTTACCATGTCGGAGCCTGTTCTTAGGCAAGCGAAGCCCAAATCCTGCCAAATTTCGTA
ATTTTGGTTGCGTCAACTGCTTAATTTGCGGTTAAGCACCCTAAAATCTTCTTGACGGGC
ACCCAAAACAAGAAATCAGGCTGAATTGCAAAAAGCAAGCTTGGAATTGTGGAGCAGCAG
GCTCACAGAAGACGTAACGCAGGCAGTTTCAACCACTTCTTGG
■■Homology search results ■■ -
sp_hit_id P56400
Definition sp|P56400|GP1BB_MOUSE Platelet glycoprotein Ib beta chain OS=Mus musculus
Align length 44
Score (bit) 30.0
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915446|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_F06.
(343 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P56400|GP1BB_MOUSE Platelet glycoprotein Ib beta chain OS=Mus... 30 3.7
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficienc... 30 4.9
sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency vi... 30 4.9
sp|P27316|RRPL_RVFVZ RNA-directed RNA polymerase OS=Rift valley ... 29 6.4
sp|B2C4J1|NCAP_CHAVB Nucleoprotein OS=Chapare virus (isolate Hum... 29 6.4

>sp|P56400|GP1BB_MOUSE Platelet glycoprotein Ib beta chain OS=Mus
musculus GN=Gp1bb PE=1 SV=1
Length = 206

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/44 (36%), Positives = 23/44 (52%)
Frame = +3

Query: 63 VPAKTAAHVSTFFMSQECRFLPCRSLFLGKRSPNPAKFRNFGCV 194
+PA AAH+ +CR LP R+ G+ P A +R+ CV
Sbjct: 78 LPALRAAHLGANPWRCDCRLLPLRAWLAGR--PERAPYRDLRCV 119


>sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency
virus type 1 (isolate ANT70 group O) GN=gag-pol PE=3
SV=3
Length = 1435

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/53 (32%), Positives = 22/53 (41%)
Frame = +3

Query: 150 KRSPNPAKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 308
+R NP + G + C CG +GH + R KK W CG G Q
Sbjct: 383 QRGQNPIRK---GTIKCFNCG------KEGHIARNCRAPRKKGCWKCGQEGHQ 426


>sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency virus
type 1 (isolate ANT70 group O) GN=gag PE=3 SV=3
Length = 498

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/53 (32%), Positives = 22/53 (41%)
Frame = +3

Query: 150 KRSPNPAKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 308
+R NP + G + C CG +GH + R KK W CG G Q
Sbjct: 383 QRGQNPIRK---GTIKCFNCG------KEGHIARNCRAPRKKGCWKCGQEGHQ 426


>sp|P27316|RRPL_RVFVZ RNA-directed RNA polymerase OS=Rift valley fever
virus (strain ZH-548 M12) GN=L PE=3 SV=1
Length = 2149

Score = 29.3 bits (64), Expect = 6.4
Identities = 21/66 (31%), Positives = 31/66 (46%)
Frame = -1

Query: 328 NCLRYVFCEPAAPQFQACFLQFSLISCFGCPSRRF*GA*PQIKQLTQPKLRNLAGFGLRL 149
NC +V CE AP+F + L+ C +R QIK + + +L + F L L
Sbjct: 2057 NC--WVRCESVAPKFISAILEI-------CEGKR------QIKGINRTRLSEIVEFVLNL 2101

Query: 148 PKNRLR 131
PK + R
Sbjct: 2102 PKIKSR 2107


>sp|B2C4J1|NCAP_CHAVB Nucleoprotein OS=Chapare virus (isolate
Human/Bolivia/810419/2003) GN=N PE=3 SV=1
Length = 562

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%)
Frame = -2

Query: 234 QEDFRVLNRKLSS*RNQNYE--IWQDLGFAC 148
++D +V++ KLSS + +NYE +W D G C
Sbjct: 468 RKDLKVVDVKLSSDQARNYEEQVWSDFGHLC 498


tr_hit_id Q8QDY9
Definition tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human immunodeficiency virus 1
Align length 47
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915446|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_F06.
(343 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human immun... 33 5.5
tr|Q8QDX0|Q8QDX0_9HIV1 Gag polyprotein OS=Human immunodeficiency... 33 5.5

>tr|Q8QDY9|Q8QDY9_9HIV1 Gag polyprotein (Fragment) OS=Human
immunodeficiency virus 1 GN=gag PE=4 SV=1
Length = 219

Score = 33.5 bits (75), Expect = 5.5
Identities = 17/47 (36%), Positives = 20/47 (42%)
Frame = +3

Query: 168 AKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 308
+ FR + C CG DGHP + R KK W CG G Q
Sbjct: 101 SNFRGPKRIKCFNCG------KDGHPARNCRAPRKKGCWKCGKEGHQ 141


>tr|Q8QDX0|Q8QDX0_9HIV1 Gag polyprotein OS=Human immunodeficiency
virus 1 GN=gag PE=4 SV=1
Length = 498

Score = 33.5 bits (75), Expect = 5.5
Identities = 17/47 (36%), Positives = 20/47 (42%)
Frame = +3

Query: 168 AKFRNFGCVNCLICG*AP*NLLDGHPKQEIRLNCKKQAWNCGAAGSQ 308
+ FR + C CG DGHP + R KK W CG G Q
Sbjct: 380 SNFRGPKRIKCFNCG------KDGHPARNCRAPRKKGCWKCGKEGHQ 420