BP915453
Clone id YMU001_000071_G01
Library
Length 303
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGCGGCCGCAGGAATTTTTTTTTTAAAGCCCTGCACCTAAAAAAGAAAAGGTTGTACCCA
ACTTTGTTTGCATCACTTTTTCTCCTAAATTGCAGAATTTCAATGAGGGTTATTTCGTCC
CAAACATTATCATTCAAGTGAATGGCGTTATACTCGAGAATGAAATGATGTAGATACACT
ACTCAGTTATCCCTACCGAAGCTGAGTCTATTTCATATGGTAAAGCGGGGAGGGGAACAA
ATGTGGGAAAGGTAGAGATAGGTACATCTATAAATAGATCTAAATATCCAACTTCATTCC
CTT
■■Homology search results ■■ -
sp_hit_id P11311
Definition sp|P11311|ADP1_MYCPN Adhesin P1 OS=Mycoplasma pneumoniae
Align length 33
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915453|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_G01.
(279 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P11311|ADP1_MYCPN Adhesin P1 OS=Mycoplasma pneumoniae GN=mgpA... 31 1.7
sp|P31118|MTC2_PBCV1 Modification methylase CviAII OS=Paramecium... 29 6.4
sp|Q8EXN4|HTPX_LEPIN Probable protease htpX homolog OS=Leptospir... 29 8.3
sp|Q75FP1|HTPX_LEPIC Probable protease htpX homolog OS=Leptospir... 29 8.3

>sp|P11311|ADP1_MYCPN Adhesin P1 OS=Mycoplasma pneumoniae GN=mgpA PE=1
SV=2
Length = 1627

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -3

Query: 262 YLDLFIDVPISTFPTFVPLPALPYEIDSASVGI 164
Y+ LFID+P S P V L L ++ + S+G+
Sbjct: 1440 YIPLFIDIPASVNPKMVRLKVLSFDTNEQSLGL 1472


>sp|P31118|MTC2_PBCV1 Modification methylase CviAII OS=Paramecium
bursaria Chlorella virus 1 GN=CVIAIIM PE=3 SV=2
Length = 326

Score = 29.3 bits (64), Expect = 6.4
Identities = 15/40 (37%), Positives = 26/40 (65%)
Frame = +3

Query: 18 KEKVVPNFVCITFSPKLQNFNEGYFVPNIIIQVNGVILEN 137
K+ V+P FV +T+SP+ N YF +I ++++ +I EN
Sbjct: 90 KDMVIPGFVTLTYSPR---GNRMYFTEDIAMRID-IIREN 125


>sp|Q8EXN4|HTPX_LEPIN Probable protease htpX homolog OS=Leptospira
interrogans GN=htpX PE=3 SV=1
Length = 295

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/54 (25%), Positives = 29/54 (53%)
Frame = +1

Query: 31 YPTLFASLFLLNCRISMRVISSQTLSFK*MALYSRMK*CRYTTQLSLPKLSLFH 192
+ +L S F+ + ++VI ++ S LYSR++ T L +P++ ++H
Sbjct: 56 FVSLLLSKFMAKMMMGVQVIDPRSASGAERELYSRVERLARTANLPMPEVGIYH 109


>sp|Q75FP1|HTPX_LEPIC Probable protease htpX homolog OS=Leptospira
interrogans serogroup Icterohaemorrhagiae serovar
copenhageni GN=htpX PE=3 SV=1
Length = 295

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/54 (25%), Positives = 29/54 (53%)
Frame = +1

Query: 31 YPTLFASLFLLNCRISMRVISSQTLSFK*MALYSRMK*CRYTTQLSLPKLSLFH 192
+ +L S F+ + ++VI ++ S LYSR++ T L +P++ ++H
Sbjct: 56 FVSLLLSKFMAKMMMGVQVIDPRSASGAERELYSRVERLARTANLPMPEVGIYH 109


tr_hit_id Q2BFD0
Definition tr|Q2BFD0|Q2BFD0_9BACI Putative uncharacterized protein OS=Bacillus sp. NRRL B-14911
Align length 48
Score (bit) 32.7
E-value 9.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915453|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_G01.
(279 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2BFD0|Q2BFD0_9BACI Putative uncharacterized protein OS=Bacil... 33 9.4

>tr|Q2BFD0|Q2BFD0_9BACI Putative uncharacterized protein OS=Bacillus
sp. NRRL B-14911 GN=B14911_03959 PE=4 SV=1
Length = 567

Score = 32.7 bits (73), Expect = 9.4
Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
Frame = -2

Query: 146 HHFILEYNAIHLNDNVWDEITLIEILQFRRKSDA------NKVGYNLF 21
H L YNA+H +D +W E E L++ + + A NK Y LF
Sbjct: 321 HEIALHYNALHQDDGIWSEKAFSEQLKWIQDASATVEIVSNKNHYTLF 368