BP915459
Clone id YMU001_000071_G10
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCACCCACGTCGTGCAGACTCTCTTGCACTACTACCCAACACCCATAACCCATCTCTCGA
CCTCTGCGTAAGCTCTTTTTCAAGACCCAACTCCGCGGTTCTCCTTCTGCTCTACGTGCC
TCACACTCAGAGAGAGAGAGCGAGAGAGAGAGAGAGCCATGGCTTCCTTCAAGATTACCC
TCTCCTTCTCCCTTCTCTCTCTTCTGATCATCTTCATCTCTGTGGCAAATGCACAACCGT
CTGCCAGCCCTGCGTCCGAGCCCACTAGCGATGGCTCAAACATCGACCTCGGCATCGCAT
ACACACTCATGTTCGCGGCGTTGGCGGTCACTTACCTGATGCACCCAATTGATGCTTTCC
CATTCAACTTGTTCTGAGGGTACACAGCAAAGAGAGCTCATTGTCTGCATTACATCACCC
ATTTGTGATGTTTTTCTAGTCTTTGTTTGGGATCTCCATCATCACACATTCTTTTGCCCA
TAATTCTTCTGCCCATTCCTTTAACAGCTTCCAAGTACTTGTGGCCTTGTAGTTGACATC
AAGAAGGGCTGGACCCTGCTTTCTTT
■■Homology search results ■■ -
sp_hit_id Q9M373
Definition sp|Q9M373|AGP20_ARATH Arabinogalactan peptide 20 OS=Arabidopsis thaliana
Align length 44
Score (bit) 56.2
E-value 1.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915459|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_G10.
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9M373|AGP20_ARATH Arabinogalactan peptide 20 OS=Arabidopsis ... 56 1e-07
sp|O82337|AGP16_ARATH Arabinogalactan peptide 16 OS=Arabidopsis ... 56 1e-07
sp|Q9FK16|AGP22_ARATH Arabinogalactan peptide 22 OS=Arabidopsis ... 51 5e-06

>sp|Q9M373|AGP20_ARATH Arabinogalactan peptide 20 OS=Arabidopsis
thaliana GN=AGP20 PE=3 SV=1
Length = 74

Score = 56.2 bits (134), Expect = 1e-07
Identities = 28/44 (63%), Positives = 34/44 (77%)
Frame = +3

Query: 225 ANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA 356
A AQ S +PA PTSDG++ID GIAY LM AL +TYL+HP+DA
Sbjct: 24 AGAQ-SLAPAPSPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDA 66


>sp|O82337|AGP16_ARATH Arabinogalactan peptide 16 OS=Arabidopsis
thaliana GN=AGP16 PE=1 SV=1
Length = 73

Score = 56.2 bits (134), Expect = 1e-07
Identities = 28/45 (62%), Positives = 35/45 (77%)
Frame = +3

Query: 222 VANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA 356
+A AQ S +PA PTSDG++ID GIAY LM AL +TYL+HP+DA
Sbjct: 23 LAGAQ-SLAPAPAPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDA 66


>sp|Q9FK16|AGP22_ARATH Arabinogalactan peptide 22 OS=Arabidopsis
thaliana GN=AGP22 PE=3 SV=1
Length = 63

Score = 50.8 bits (120), Expect = 5e-06
Identities = 23/35 (65%), Positives = 28/35 (80%)
Frame = +3

Query: 240 SASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMH 344
S+SPA PTSDG++ID GIAY LM ALA+TY +H
Sbjct: 29 SSSPAPAPTSDGTSIDQGIAYVLMMVALALTYFIH 63


tr_hit_id A9NL94
Definition tr|A9NL94|A9NL94_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 50
Score (bit) 72.8
E-value 1.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915459|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_G10.
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NL94|A9NL94_PICSI Putative uncharacterized protein OS=Picea... 73 1e-11
tr|B6TQ77|B6TQ77_MAIZE AGP16 OS=Zea mays PE=4 SV=1 60 8e-08
tr|B6SR56|B6SR56_MAIZE AGP16 OS=Zea mays PE=4 SV=1 60 8e-08
tr|B6SMF8|B6SMF8_MAIZE AGP16 OS=Zea mays PE=4 SV=1 60 8e-08
tr|Q94DB9|Q94DB9_ORYSJ cDNA clone:002-150-C11, full insert seque... 59 1e-07
tr|A5BTA7|A5BTA7_VITVI Putative uncharacterized protein (Chromos... 59 1e-07
tr|A2WTE3|A2WTE3_ORYSI Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|B8B358|B8B358_ORYSI Putative uncharacterized protein OS=Oryza... 59 2e-07
tr|A9PBL3|A9PBL3_POPTR Putative uncharacterized protein OS=Popul... 58 3e-07
tr|B6SPA0|B6SPA0_MAIZE AGP20 OS=Zea mays PE=4 SV=1 58 4e-07
tr|B4FIH4|B4FIH4_MAIZE Putative uncharacterized protein OS=Zea m... 58 4e-07
tr|Q8S344|Q8S344_CAPAN Putative uncharacterized protein upa9 OS=... 57 5e-07
tr|Q6ETY5|Q6ETY5_ORYSJ Os02g0264800 protein OS=Oryza sativa subs... 57 5e-07
tr|A2X375|A2X375_ORYSI Putative uncharacterized protein OS=Oryza... 57 5e-07
tr|Q6I5W4|Q6I5W4_ORYSJ Os05g0217000 protein OS=Oryza sativa subs... 56 2e-06
tr|A2Y1M8|A2Y1M8_ORYSI Putative uncharacterized protein OS=Oryza... 56 2e-06
tr|A5AM00|A5AM00_VITVI Putative uncharacterized protein (Chromos... 52 2e-05
tr|Q8L9T8|Q8L9T8_ARATH Putative uncharacterized protein (At5g241... 52 3e-05
tr|B6T2G3|B6T2G3_MAIZE AGP16 OS=Zea mays PE=4 SV=1 52 3e-05
tr|B4FD31|B4FD31_MAIZE Putative uncharacterized protein OS=Zea m... 52 3e-05
tr|A9PA79|A9PA79_POPTR Putative uncharacterized protein OS=Popul... 52 3e-05
tr|A5B2M5|A5B2M5_VITVI Putative uncharacterized protein OS=Vitis... 50 1e-04
tr|A9NR89|A9NR89_PICSI Putative uncharacterized protein OS=Picea... 49 1e-04
tr|B6T179|B6T179_MAIZE AGP16 OS=Zea mays PE=4 SV=1 48 4e-04
tr|Q6H8D2|Q6H8D2_ORYSJ Putative uncharacterized protein OJ1006_A... 42 0.018
tr|A2X2A7|A2X2A7_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.089
tr|Q5ZD40|Q5ZD40_ORYSJ Putative uncharacterized protein P0710A02... 37 0.98
tr|A2WS21|A2WS21_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.98
tr|B8AB42|B8AB42_ORYSI Putative uncharacterized protein OS=Oryza... 35 2.2
tr|A3B0K5|A3B0K5_ORYSJ Putative uncharacterized protein OS=Oryza... 35 2.9

>tr|A9NL94|A9NL94_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 73

Score = 72.8 bits (177), Expect = 1e-11
Identities = 35/50 (70%), Positives = 42/50 (84%)
Frame = +3

Query: 225 ANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDAFPFNLF 374
ANAQ +PA PTSDG++ID GIAY LMF ALA+TYL+HP+DAFP+NLF
Sbjct: 27 ANAQ---APAPAPTSDGTSIDQGIAYVLMFLALALTYLIHPLDAFPYNLF 73


>tr|B6TQ77|B6TQ77_MAIZE AGP16 OS=Zea mays PE=4 SV=1
Length = 76

Score = 60.1 bits (144), Expect = 8e-08
Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 1/49 (2%)
Frame = +3

Query: 231 AQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA-FPFNLF 374
A + +PA PTSDG++IDLGIAY LM AL +TYL+HP+DA P+ LF
Sbjct: 28 AAAAQAPAPAPTSDGTSIDLGIAYILMLVALVLTYLIHPLDASSPYKLF 76


>tr|B6SR56|B6SR56_MAIZE AGP16 OS=Zea mays PE=4 SV=1
Length = 73

Score = 60.1 bits (144), Expect = 8e-08
Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 1/49 (2%)
Frame = +3

Query: 231 AQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA-FPFNLF 374
A + +PA PTSDG++IDLGIAY LM AL +TYL+HP+DA P+ LF
Sbjct: 25 AAAAQAPAPAPTSDGTSIDLGIAYILMLVALVLTYLIHPLDASSPYKLF 73


>tr|B6SMF8|B6SMF8_MAIZE AGP16 OS=Zea mays PE=4 SV=1
Length = 75

Score = 60.1 bits (144), Expect = 8e-08
Identities = 29/49 (59%), Positives = 37/49 (75%), Gaps = 1/49 (2%)
Frame = +3

Query: 231 AQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA-FPFNLF 374
A + +PA PTSDG++IDLGIAY LM AL +TYL+HP+DA P+ LF
Sbjct: 27 AAAAQAPAPAPTSDGTSIDLGIAYILMLVALVLTYLIHPLDASSPYKLF 75


>tr|Q94DB9|Q94DB9_ORYSJ cDNA clone:002-150-C11, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0694A04.20 PE=4 SV=1
Length = 69

Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/45 (62%), Positives = 36/45 (80%)
Frame = +3

Query: 222 VANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA 356
+ NAQ +PA PTSDG+++D GIAY LMF ALA+TYL+HP+DA
Sbjct: 21 LVNAQ---APAPAPTSDGTSVDQGIAYVLMFVALALTYLIHPLDA 62


>tr|A5BTA7|A5BTA7_VITVI Putative uncharacterized protein (Chromosome
chr15 scaffold_40, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00026982001 PE=4 SV=1
Length = 75

Score = 59.3 bits (142), Expect = 1e-07
Identities = 30/50 (60%), Positives = 36/50 (72%)
Frame = +3

Query: 225 ANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDAFPFNLF 374
A AQ SA PA PTSDG+ ID GIAY LM AL +TYL+HP+DA ++ F
Sbjct: 27 ARAQSSA-PAPAPTSDGTAIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75


>tr|A2WTE3|A2WTE3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03127 PE=4 SV=1
Length = 69

Score = 59.3 bits (142), Expect = 1e-07
Identities = 28/45 (62%), Positives = 36/45 (80%)
Frame = +3

Query: 222 VANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA 356
+ NAQ +PA PTSDG+++D GIAY LMF ALA+TYL+HP+DA
Sbjct: 21 LVNAQ---APAPAPTSDGTSVDQGIAYVLMFVALALTYLIHPLDA 62


>tr|B8B358|B8B358_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23127 PE=4 SV=1
Length = 77

Score = 58.9 bits (141), Expect = 2e-07
Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
Frame = +3

Query: 231 AQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA-FPFNLF 374
A P+ PA P+SDG++ID GIAY LM AL +TYL+HP+DA P+ LF
Sbjct: 29 AAPAQPPAPAPSSDGTSIDQGIAYVLMLVALVLTYLIHPLDASSPYKLF 77


>tr|A9PBL3|A9PBL3_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=4 SV=1
Length = 76

Score = 58.2 bits (139), Expect = 3e-07
Identities = 26/45 (57%), Positives = 33/45 (73%)
Frame = +3

Query: 240 SASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDAFPFNLF 374
S +PA PTSDG++ID GIAY LM AL +TYL+HP+DA + F
Sbjct: 32 SPAPAPAPTSDGTSIDQGIAYLLMLVALVLTYLIHPLDASSYTFF 76


>tr|B6SPA0|B6SPA0_MAIZE AGP20 OS=Zea mays PE=4 SV=1
Length = 72

Score = 57.8 bits (138), Expect = 4e-07
Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 1/51 (1%)
Frame = +3

Query: 225 ANAQPSASPASEPTSDGSNIDLGIAYTLMFAALAVTYLMHPIDA-FPFNLF 374
A A + +PA PTSDG++ID GIAY LM AL +TYL+HP+DA P+ LF
Sbjct: 22 AVAAAAQAPAPAPTSDGTSIDQGIAYLLMIMALVLTYLIHPLDASAPYKLF 72