BP915462
Clone id YMU001_000071_H05
Library
Length 384
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000071_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTGCACGGCGGGTCTGTCGTGCACGAGGATTCACTGACGGCCAGCTATGGCACAGGTTT
TGAGATGGGAATGAGCTTCCACCAGGCGGTATTGCAGGGAATGGACTATGCTGATTTACC
TTATGTTGAAGACATAAAGAGTTGGCCAGCGCTCCCCACTATGGAGGAGATTGTATGGGA
TCCGATGGATGAAATCGAAAAGGCTGTTTCTGATGGGCTATATATTGTTGCAAGTAAAAG
TCTGAATCATCTATATTTTTAAAGGTTTATGAGGTTGACAATCTCAATACCCTCGTGTGT
GTCCCAAAGGATCTTACACCAAGCAACGAAAGCCCCACTAAAGTCTTGATGCTTCAACCA
ACATTGTCAGATTGCGTGATCAAC
■■Homology search results ■■ -
sp_hit_id Q5GRK0
Definition sp|Q5GRK0|SYV_WOLTR Valyl-tRNA synthetase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS)
Align length 75
Score (bit) 32.3
E-value 0.74
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915462|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_H05.
(384 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5GRK0|SYV_WOLTR Valyl-tRNA synthetase OS=Wolbachia sp. subsp... 32 0.74
sp|Q73HS9|SYV_WOLPM Valyl-tRNA synthetase OS=Wolbachia pipientis... 31 1.7
sp|Q12096|GNT1_YEAST Glucose N-acetyltransferase 1 OS=Saccharomy... 30 2.9
sp|A6L997|SECA_PARD8 Protein translocase subunit secA OS=Parabac... 30 3.7
sp|Q3ZJ90|RPOC2_PSEAK DNA-directed RNA polymerase subunit beta''... 29 6.3
sp|A6VL83|HCP_ACTSZ Hydroxylamine reductase OS=Actinobacillus su... 29 8.2

>sp|Q5GRK0|SYV_WOLTR Valyl-tRNA synthetase OS=Wolbachia sp. subsp.
Brugia malayi (strain TRS) GN=valS PE=3 SV=1
Length = 855

Score = 32.3 bits (72), Expect = 0.74
Identities = 17/75 (22%), Positives = 35/75 (46%)
Frame = +2

Query: 35 LTASYGTGFEMGMSFHQAVLQGMDYADLPYVEDIKSWPALPTMEEIVWDPMDEIEKAVSD 214
L S G ++ + +H + + + + +++ A M+ I+WDP+D+ A ++
Sbjct: 124 LLRSVGISYDWSLEYHTISKETVTLSQMSFIDLYNKGYAYRKMQPILWDPVDKTAIAQAE 183

Query: 215 GLYIVASKSLNHLYF 259
V SLN + F
Sbjct: 184 IEDKVCESSLNTITF 198


>sp|Q73HS9|SYV_WOLPM Valyl-tRNA synthetase OS=Wolbachia pipientis
wMel GN=valS PE=3 SV=1
Length = 864

Score = 31.2 bits (69), Expect = 1.7
Identities = 17/75 (22%), Positives = 35/75 (46%)
Frame = +2

Query: 35 LTASYGTGFEMGMSFHQAVLQGMDYADLPYVEDIKSWPALPTMEEIVWDPMDEIEKAVSD 214
L S G ++ + +H + + + + +++ A M+ I+WDP+D+ A ++
Sbjct: 124 LFKSVGISYDWDLEYHTISKETVTLSQMSFIDLYNKGYAYRKMQPILWDPVDKTAIAQAE 183

Query: 215 GLYIVASKSLNHLYF 259
V SLN + F
Sbjct: 184 IEDKVFESSLNTIVF 198


>sp|Q12096|GNT1_YEAST Glucose N-acetyltransferase 1 OS=Saccharomyces
cerevisiae GN=GNT1 PE=1 SV=1
Length = 491

Score = 30.4 bits (67), Expect = 2.9
Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%)
Frame = +1

Query: 247 SSIFLKVYEVDNLNTLVCV------PKDLTPSNESPTKVLMLQPTLSDCVI 381
SS+ K+ +D ++ + PKD TP NES TK+L+ T D VI
Sbjct: 145 SSLLNKIQAIDEDQVVIKLIDNIVKPKDTTPWNESLTKLLVFNQTEFDRVI 195


>sp|A6L997|SECA_PARD8 Protein translocase subunit secA
OS=Parabacteroides distasonis (strain ATCC 8503 / DSM
20701 / NCTC 11152) GN=secA PE=3 SV=1
Length = 1126

Score = 30.0 bits (66), Expect = 3.7
Identities = 11/30 (36%), Positives = 21/30 (70%)
Frame = +2

Query: 167 EIVWDPMDEIEKAVSDGLYIVASKSLNHLY 256
E +W +D+IEKA++D + +V +SL ++
Sbjct: 82 EAIWAEVDKIEKAITDKMEVVLEQSLPEVF 111


>sp|Q3ZJ90|RPOC2_PSEAK DNA-directed RNA polymerase subunit beta''
OS=Pseudendoclonium akinetum GN=rpoC2 PE=3 SV=1
Length = 3462

Score = 29.3 bits (64), Expect = 6.3
Identities = 13/28 (46%), Positives = 18/28 (64%)
Frame = +2

Query: 236 KSLNHLYF*RFMRLTISIPSCVSQRILH 319
K+LN+ YF F+ L P CVS++ LH
Sbjct: 846 KNLNYQYFHPFLVLASDPPFCVSEKTLH 873


>sp|A6VL83|HCP_ACTSZ Hydroxylamine reductase OS=Actinobacillus
succinogenes (strain ATCC 55618 / 130Z) GN=hcp PE=3 SV=1
Length = 553

Score = 28.9 bits (63), Expect = 8.2
Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
Frame = +2

Query: 104 DYADLPYVEDIKSWPALPTMEEIVWDPMDEIEKAVS-DGLYIVASKSLNHLYF*RFMRLT 280
DYAD + +I WP + +EE + P+ IEKA+ DG L HL F R T
Sbjct: 325 DYADRIFTRNIVGWPGVTHLEEHDFSPV--IEKALECDGF---PYTELEHLITVGFGRKT 379

Query: 281 I 283
+
Sbjct: 380 L 380


tr_hit_id A5BZD8
Definition tr|A5BZD8|A5BZD8_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 57
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915462|Adiantum capillus-veneris mRNA, clone:
YMU001_000071_H05.
(384 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BZD8|A5BZD8_VITVI Putative uncharacterized protein OS=Vitis... 34 4.2
tr|A9UQ99|A9UQ99_MONBE Predicted protein OS=Monosiga brevicollis... 33 5.5
tr|A9EW02|A9EW02_SORC5 Conserved exported carbohydrate-binding p... 33 7.2
tr|B2VR47|B2VR47_PYRTR Rho1 guanine nucleotide exchange factor 1... 33 7.2
tr|B6GWD3|B6GWD3_PENCH Peroxisome targeting signal receptor Pex7... 33 9.4
tr|A4GFM1|A4GFM1_PENCH Peroxin 7 OS=Penicillium chrysogenum GN=P... 33 9.4

>tr|A5BZD8|A5BZD8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035995 PE=4 SV=1
Length = 686

Score = 33.9 bits (76), Expect = 4.2
Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 12/57 (21%)
Frame = -2

Query: 212 QKQPFRFHPSDPIQSPP*WG--------ALANSLCLQHKVNQHSPFP----AIPPGG 78
++QP HP + + P WG L+ S CL H +++H P P +PPGG
Sbjct: 119 KEQPQGLHPESALTNMPDWGLGVGNSKPILSGSWCLHH-LHRHGPIPPGSCLLPPGG 174


>tr|A9UQ99|A9UQ99_MONBE Predicted protein OS=Monosiga brevicollis
GN=30936 PE=4 SV=1
Length = 1093

Score = 33.5 bits (75), Expect = 5.5
Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 5/109 (4%)
Frame = +2

Query: 8 GGSVVHEDSLTASYGTGFEMGMSFHQAVLQGMDYADLPYVEDIKSWPALPTMEEI---VW 178
GG V D+LT G G+S Q+++QG A + +ED + A+P EE+ +
Sbjct: 316 GGVVGAADALTGGLVAGMAAGLSMVQSIIQGNVCAAI-CIEDAAAQAAMPNKEEVQSFLH 374

Query: 179 DPMDEIEKAVSDGLYIVASKSLNHLYF*RFMRLTISIPSCV--SQRILH 319
D +++ ++D + S L R L IS V +Q++ H
Sbjct: 375 DTSTQLDLDINDDFPLGPSDDL------RLKTLDISWAKAVLSNQQVTH 417


>tr|A9EW02|A9EW02_SORC5 Conserved exported carbohydrate-binding
protein,Rhs family OS=Sorangium cellulosum (strain So
ce56) GN=sce4111 PE=4 SV=1
Length = 1310

Score = 33.1 bits (74), Expect = 7.2
Identities = 13/24 (54%), Positives = 17/24 (70%)
Frame = +2

Query: 155 PTMEEIVWDPMDEIEKAVSDGLYI 226
P + EIVW+ +D +EK V DGL I
Sbjct: 774 PVVTEIVWNDLDRVEKVVQDGLAI 797


>tr|B2VR47|B2VR47_PYRTR Rho1 guanine nucleotide exchange factor 1
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_00396 PE=4 SV=1
Length = 1273

Score = 33.1 bits (74), Expect = 7.2
Identities = 28/91 (30%), Positives = 38/91 (41%), Gaps = 16/91 (17%)
Frame = -2

Query: 236 YLQQYIAHQKQPF----RFHPSDPIQSPP*W-----------GALANSLCLQHKVNQHSP 102
YL Q + ++QP+ RF P P+ PP G N+ + + +P
Sbjct: 147 YLPQPLRPERQPYGQPQRFDPRTPVGQPPYNKPIPNRFPGPPGPAMNADPYRSQSLALNP 206

Query: 101 FPAIPPGGSSFPSQ-NLCHSWPSVNPRARQT 12
P PGG S PSQ N P +N AR T
Sbjct: 207 RPQFTPGGPSHPSQANTFRQQPYMNHMARTT 237


>tr|B6GWD3|B6GWD3_PENCH Peroxisome targeting signal receptor
Pex7-Penicillium chrysogenum OS=Penicillium chrysogenum
Wisconsin 54-1255 GN=Pc06g01630 PE=4 SV=1
Length = 350

Score = 32.7 bits (73), Expect = 9.4
Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
Frame = -2

Query: 146 ANSLCLQHKVNQHSPFPAIP--PGGSSFPSQNLCHSWPSVNPRARQT 12
+N L Q ++ P PAIP PGG + P++ L H W P T
Sbjct: 182 SNHLVTQIPIHAGPPAPAIPGQPGGPAPPAEALTHDWNKYRPTVLAT 228


>tr|A4GFM1|A4GFM1_PENCH Peroxin 7 OS=Penicillium chrysogenum GN=PEX7
PE=4 SV=1
Length = 350

Score = 32.7 bits (73), Expect = 9.4
Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
Frame = -2

Query: 146 ANSLCLQHKVNQHSPFPAIP--PGGSSFPSQNLCHSWPSVNPRARQT 12
+N L Q ++ P PAIP PGG + P++ L H W P T
Sbjct: 182 SNHLVTQIPIHAGPPAPAIPGQPGGPAPPAEALTHDWNKYRPTVLAT 228