BP915480
Clone id YMU001_000072_B05
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000072_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGCAAGGTGATCTTTAGAGCAAAATGGCCACCACATGCGCCTTCATGATTCTCTTCCAAC
ACTCTGTAAAGCTCCTCCCGCCAAGGTACACGTCTCAACACGAGATCAGCCCCTTTCATG
TATAAGACATCACCAATCAATTTGTACCTGTATGCTCTACGCAGCAAAGCCATACTTCTT
AGACTTCTGAATCTCCTTTGGAATGATTCCTATTAGCAAAAAATCCTCTGGACTGACTAC
AACTGGACTCACCCATTCTGTGGTCTCCACAGGGACTATGAACCCTGCCTTCAATAACTT
GTCAACCTCTTCTCGCAAGGCTTCCATTTGATCTTGACCCATCCTTCTTAGCCTTTGCCG
CACTGGTTTAGCACCTTCTTTCAGCTCTATATGCATCTCTTCCCCCTTGAACCCTCTGAT
CTCTTCATATGAAGTAATGAACAAATCAGGAAAACTAGCCAGCATTTGCAAATATATCTC
CTTCTCCATAGTTGAGAGGTCTCCACTGAT
■■Homology search results ■■ -
sp_hit_id Q09575
Definition sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans
Align length 95
Score (bit) 43.1
E-value 0.0007
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915480|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_B05.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorha... 43 7e-04
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus ... 37 0.070
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pr... 34 0.35
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1... 31 2.9
sp|P15599|CH601_CHLCV 60 kDa chaperonin 1 OS=Chlamydophila cavia... 30 6.5
sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 O... 30 6.6
sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 O... 30 6.6
sp|Q5KIA9|SET1_CRYNE Histone-lysine N-methyltransferase, H3 lysi... 30 8.5

>sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6
OS=Caenorhabditis elegans GN=K02A2.6 PE=2 SV=1
Length = 1268

Score = 43.1 bits (100), Expect = 7e-04
Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 3/95 (3%)
Frame = -1

Query: 510 ISGDLSTMEKE---IYLQMLASFPDLFITSYEEIRGFKGEEMHIELKEGAKPVRQRLRRM 340
I +ST E E + + + FP++F + + E+ +E A PV +R R +
Sbjct: 392 IVNQVSTSETEASRLEVMLKNDFPEVF---KDGLGLCTKEKAEFRTEENAVPVFKRARPV 448

Query: 339 GQDQMEALREEVDKLLKAGFIVPVETTEWVSPVVV 235
+EA+ E+++L + G IVP+ +W +P+VV
Sbjct: 449 PYGSLEAVETELNRLQEMGVIVPITYAKWAAPIVV 483


>sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus
GN=pol PE=3 SV=1
Length = 1165

Score = 36.6 bits (83), Expect = 0.070
Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
Frame = -1

Query: 486 EKEIYLQMLASFPDLFITSYEEIRGF----KGEEMHIELKEGAKPVRQRLRRMGQDQMEA 319
EK + + S+ LF T + E G + + +EL+ GA PV R M ++ E
Sbjct: 131 EKPVPSSIDPSWLQLFPTVWAERAGMGLANQVPPVVVELRSGASPVAVRQYPMSKEAREG 190

Query: 318 LREEVDKLLKAGFIVPVETTEWVSPVV 238
+R + K L G +VP + W +P++
Sbjct: 191 IRPHIQKFLDLGVLVPCR-SPWNTPLL 216


>sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus
GN=pro-pol PE=3 SV=1
Length = 1127

Score = 34.3 bits (77), Expect = 0.35
Identities = 16/51 (31%), Positives = 28/51 (54%)
Frame = -1

Query: 390 IELKEGAKPVRQRLRRMGQDQMEALREEVDKLLKAGFIVPVETTEWVSPVV 238
+ELK A PV R M ++ E +R + + L G +VP + + W +P++
Sbjct: 129 VELKSDASPVAVRQYPMSKEAREGIRPHIQRFLDLGILVPCQ-SPWNTPLL 178


>sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1
OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=2
Length = 1852

Score = 31.2 bits (69), Expect = 2.9
Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
Frame = -1

Query: 489 MEKEIYLQMLASFPDLFITSYEEIRGFKGEEMH-IELKEGAKPVRQRLRRMGQDQMEALR 313
++K++ ++M+A + I G G ++H I + A+ + RLR G+D+ EA
Sbjct: 1212 VDKKLTMEMIA----------DRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGEDKGEAQE 1261

Query: 312 EEVDKLLKAGFIVPVE 265
E+VDK+ F+ +E
Sbjct: 1262 EQVDKMEDDVFLRCIE 1277


>sp|P15599|CH601_CHLCV 60 kDa chaperonin 1 OS=Chlamydophila caviae
GN=groL1 PE=2 SV=1
Length = 544

Score = 30.0 bits (66), Expect = 6.5
Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 5/72 (6%)
Frame = -1

Query: 381 KEGAKPVRQRLRRMGQDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPEDFL----- 217
KEGA +Q L R + +ALR+ +++AG + P + T S L
Sbjct: 462 KEGAIICQQVLSRSSSEGYDALRDAYTDMIEAGILDPTKVTRCALESAASVAGLLLTTEA 521

Query: 216 LIGIIPKEIQKS 181
LI IP+E S
Sbjct: 522 LIADIPEEKSSS 533


>sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 OS=Mus
musculus GN=Usp34 PE=1 SV=3
Length = 3582

Score = 30.0 bits (66), Expect = 6.6
Identities = 12/24 (50%), Positives = 16/24 (66%)
Frame = +2

Query: 32 HMRLHDSLPTLCKAPPAKVHVSTR 103
HM+ HD L TLC+ + +HV TR
Sbjct: 3549 HMQQHDILDTLCRTIESTIHVVTR 3572


>sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34
OS=Homo sapiens GN=USP34 PE=1 SV=2
Length = 3546

Score = 30.0 bits (66), Expect = 6.6
Identities = 12/24 (50%), Positives = 16/24 (66%)
Frame = +2

Query: 32 HMRLHDSLPTLCKAPPAKVHVSTR 103
HM+ HD L TLC+ + +HV TR
Sbjct: 3513 HMQQHDILDTLCRTIESTIHVVTR 3536


>sp|Q5KIA9|SET1_CRYNE Histone-lysine N-methyltransferase, H3 lysine-4
specific OS=Cryptococcus neoformans GN=SET1 PE=3 SV=1
Length = 1469

Score = 29.6 bits (65), Expect = 8.5
Identities = 13/36 (36%), Positives = 22/36 (61%)
Frame = -1

Query: 324 EALREEVDKLLKAGFIVPVETTEWVSPVVVSPEDFL 217
+ ++ EVDKLL +G ++ E W+ V+ + ED L
Sbjct: 1193 KVVKTEVDKLLASGVLMDEEDAYWLGRVLAAQEDGL 1228


tr_hit_id Q7FAH7
Definition tr|Q7FAH7|Q7FAH7_ORYSJ OSJNBa0073L13.2 protein OS=Oryza sativa subsp. japonica
Align length 95
Score (bit) 66.2
E-value 9.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915480|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_B05.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7FAH7|Q7FAH7_ORYSJ OSJNBa0073L13.2 protein OS=Oryza sativa s... 66 9e-10
tr|A5BSJ3|A5BSJ3_VITVI Putative uncharacterized protein OS=Vitis... 65 1e-09
tr|A5C1W7|A5C1W7_VITVI Putative uncharacterized protein OS=Vitis... 65 2e-09
tr|A5BSV0|A5BSV0_VITVI Putative uncharacterized protein OS=Vitis... 65 2e-09
tr|A5BRI1|A5BRI1_VITVI Putative uncharacterized protein (Fragmen... 65 2e-09
tr|A5B120|A5B120_VITVI Putative uncharacterized protein OS=Vitis... 65 2e-09
tr|A5AZ81|A5AZ81_VITVI Putative uncharacterized protein OS=Vitis... 65 2e-09
tr|A5AZ15|A5AZ15_VITVI Putative uncharacterized protein OS=Vitis... 65 2e-09
tr|A5C6U7|A5C6U7_VITVI Putative uncharacterized protein OS=Vitis... 65 3e-09
tr|A5BHA9|A5BHA9_VITVI Putative uncharacterized protein OS=Vitis... 65 3e-09
tr|Q2AA19|Q2AA19_ASPOF RNase H family protein OS=Asparagus offic... 64 3e-09
tr|A5B6Y5|A5B6Y5_VITVI Putative uncharacterized protein OS=Vitis... 64 3e-09
tr|A5B3S7|A5B3S7_VITVI Putative uncharacterized protein OS=Vitis... 64 3e-09
tr|A5BB53|A5BB53_VITVI Putative uncharacterized protein OS=Vitis... 64 4e-09
tr|A2Q2J0|A2Q2J0_MEDTR RNA-directed DNA polymerase (Reverse tran... 64 4e-09
tr|Q7X8F3|Q7X8F3_ORYSJ OSJNBa0093P23.5 protein (OSJNBa0041M21.10... 64 6e-09
tr|Q01LU7|Q01LU7_ORYSA OSIGBa0136B09.4 protein OS=Oryza sativa G... 64 6e-09
tr|A5CA12|A5CA12_VITVI Putative uncharacterized protein OS=Vitis... 64 6e-09
tr|A5C5F1|A5C5F1_VITVI Putative uncharacterized protein OS=Vitis... 64 6e-09
tr|A5BFP7|A5BFP7_VITVI Putative uncharacterized protein OS=Vitis... 64 6e-09
tr|A5AY22|A5AY22_VITVI Putative uncharacterized protein OS=Vitis... 64 6e-09
tr|A5ACR1|A5ACR1_VITVI Putative uncharacterized protein OS=Vitis... 64 6e-09
tr|Q2R431|Q2R431_ORYSJ Retrotransposon protein, putative, Ty3-gy... 63 7e-09
tr|A5BVK4|A5BVK4_VITVI Putative uncharacterized protein OS=Vitis... 63 7e-09
tr|A5BDL7|A5BDL7_VITVI Putative uncharacterized protein OS=Vitis... 63 7e-09
tr|A5C6G8|A5C6G8_VITVI Putative uncharacterized protein OS=Vitis... 63 1e-08
tr|A5BYJ0|A5BYJ0_VITVI Putative uncharacterized protein OS=Vitis... 63 1e-08
tr|A5BYG4|A5BYG4_VITVI Putative uncharacterized protein OS=Vitis... 63 1e-08
tr|A5BDN9|A5BDN9_VITVI Putative uncharacterized protein OS=Vitis... 63 1e-08
tr|Q6I5B8|Q6I5B8_ORYSJ Putative polyprotein OS=Oryza sativa subs... 62 1e-08

>tr|Q7FAH7|Q7FAH7_ORYSJ OSJNBa0073L13.2 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0073L13.2 PE=4 SV=1
Length = 943

Score = 66.2 bits (160), Expect = 9e-10
Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGEEM--HIELKEGAKPVRQRLRRMG 337
+ GD+ E E L++L D+F S +E+ G + + H+ +K AKP +Q+LR+M
Sbjct: 134 LGGDMGEREAENILEVLKKNIDIFAWSPDEVGGVSTDLIMHHLAVKPEAKPSKQKLRKMS 193

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWV-SPVVV 235
D+ EA + EV KLLKAG I ++ EW+ +PV+V
Sbjct: 194 ADRQEAAKAEVQKLLKAGVIQEIDHPEWLANPVLV 228


>tr|A5BSJ3|A5BSJ3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_008285 PE=4 SV=1
Length = 2237

Score = 65.5 bits (158), Expect = 1e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1188 IGSDLSTDERDSLIQLLRSYSDVFAWSYEDMPGLDPSIVQHRLPLLPHARPVKQKLRRLH 1247

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1248 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 1284


>tr|A5C1W7|A5C1W7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_002875 PE=4 SV=1
Length = 1391

Score = 65.1 bits (157), Expect = 2e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 536 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPQARPVKQKLRRLH 595

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 596 HRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 632


>tr|A5BSV0|A5BSV0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_015119 PE=4 SV=1
Length = 2077

Score = 65.1 bits (157), Expect = 2e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1163 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPXARPVKQKLRRLH 1222

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1223 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 1259


>tr|A5BRI1|A5BRI1_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_030726 PE=4 SV=1
Length = 1957

Score = 65.1 bits (157), Expect = 2e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1113 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPXARPVKQKLRRLH 1172

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1173 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 1209


>tr|A5B120|A5B120_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028523 PE=4 SV=1
Length = 2317

Score = 65.1 bits (157), Expect = 2e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1244 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPQARPVKQKLRRLH 1303

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1304 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPXPK 1340


>tr|A5AZ81|A5AZ81_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004793 PE=4 SV=1
Length = 2115

Score = 65.1 bits (157), Expect = 2e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1128 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPQARPVKQKLRRLH 1187

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1188 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVXVPK 1224


>tr|A5AZ15|A5AZ15_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005472 PE=4 SV=1
Length = 1303

Score = 65.1 bits (157), Expect = 2e-09
Identities = 39/112 (34%), Positives = 66/112 (58%), Gaps = 2/112 (1%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGEEMH--IELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + L A+PV+Q+LRR+
Sbjct: 777 IRSDLSTDERDGLIQLLRSYLDVFAWSYEDMPGLDLSIFQHCLPLLPHARPVKQKLRRLH 836

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPEDFLLIGIIPKEIQKS 181
++EE+ K L GF+ VE EW++ VV+ P+ I + P++++K+
Sbjct: 837 PRWSLQVKEEIQKQLIVGFLSVVEYPEWLANVVLVPKKNGKILMAPEDMEKT 888


>tr|A5C6U7|A5C6U7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004899 PE=4 SV=1
Length = 2452

Score = 64.7 bits (156), Expect = 3e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 516 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPHARPVKQKLRRLH 575

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 576 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 612


>tr|A5BHA9|A5BHA9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034081 PE=4 SV=1
Length = 1998

Score = 64.7 bits (156), Expect = 3e-09
Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)
Frame = -1

Query: 510 ISGDLSTMEKEIYLQMLASFPDLFITSYEEIRGFKGE--EMHIELKEGAKPVRQRLRRMG 337
I DLST E++ +Q+L S+ D+F SYE++ G + + L A+PV+Q+LRR+
Sbjct: 1024 IGSDLSTDERDSLIQLLRSYLDVFAWSYEDMPGLDPSIVQHRLPLLPQARPVKQKLRRLH 1083

Query: 336 QDQMEALREEVDKLLKAGFIVPVETTEWVSPVVVSPE 226
++EE+ K L GF+ VE EW++ VV P+
Sbjct: 1084 PRWSLQVKEEIQKQLSVGFLSVVEYPEWLANVVPVPK 1120