BP915497
Clone id YMU001_000072_C12
Library
Length 549
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000072_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGCTCAATCGACCATGCTTGTTTCAGCTTTTGATGTGCAGAAGAAACGGCCAAAGTGCC
TGCAAATGTTGGCACTTTTGTATCACGTCATTTAAATCTACATCAGTAGAGCCTTAAAAA
GCCCTATTTCAATTTTGCCCTTGCAATCTGCTGAGATCTAATTAACACAATCGCCATACA
GGCCTGTTTGCTAGGCAATACAAATGAAGGGGGTAACGAATGCCCTTCCCCCACAACATT
ACTTTACAAAAGTTATGTTCAGACAGGTGTTGCACCTCCCTAGTAGGGATTATATCGGCG
GGAATTACCAGCTTGTTTTTGAGAATGCGGTCCACGACCACCGCCTCTATCTTCTCTATC
ATATGCACTGACTGATGGCGCTACTGCAGTGCCTGATTGTTGCAGAACATAGCCAATACG
CCCATCTGGTAGCATCATTGGCACCATGGCCATTCCAGCAGGTGTGGGCCCTCGGCCATA
GATAACAGGCTGTACCTGCCCAAATCCTCTGCTTCCACTGAATCCCATTGCCATGCCACC
GTACATATT
■■Homology search results ■■ -
sp_hit_id Q6IPW1
Definition sp|Q6IPW1|CK071_HUMAN Uncharacterized protein C11orf71 OS=Homo sapiens
Align length 37
Score (bit) 32.7
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915497|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_C12.
(549 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6IPW1|CK071_HUMAN Uncharacterized protein C11orf71 OS=Homo s... 33 1.2

>sp|Q6IPW1|CK071_HUMAN Uncharacterized protein C11orf71 OS=Homo
sapiens GN=C11orf71 PE=2 SV=2
Length = 123

Score = 32.7 bits (73), Expect = 1.2
Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
Frame = -1

Query: 387 AVAPSVSAYDREDRGGGRGPHSQKQAGNSR--RYNPY 283
AV PSV A R GGGR P G SR R++PY
Sbjct: 56 AVRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPY 92


tr_hit_id Q2HTD6
Definition tr|Q2HTD6|Q2HTD6_MEDTR RNA-binding region RNP-1 (RNA recognition motif); Calcium-binding EF-hand OS=Medicago truncatula
Align length 91
Score (bit) 90.9
E-value 4.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915497|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_C12.
(549 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2HTD6|Q2HTD6_MEDTR RNA-binding region RNP-1 (RNA recognition... 91 4e-17
tr|A7QFA8|A7QFA8_VITVI Chromosome undetermined scaffold_87, whol... 86 1e-15
tr|A9NVU4|A9NVU4_PICSI Putative uncharacterized protein OS=Picea... 85 3e-15
tr|A7PXS3|A7PXS3_VITVI Chromosome chr15 scaffold_37, whole genom... 84 6e-15
tr|B4F9N8|B4F9N8_MAIZE Putative uncharacterized protein OS=Zea m... 83 1e-14
tr|Q53JL6|Q53JL6_ORYSJ RNA recognition motif family protein, exp... 82 1e-14
tr|Q0ITI7|Q0ITI7_ORYSJ Os11g0250000 protein OS=Oryza sativa subs... 82 1e-14
tr|A2ZD39|A2ZD39_ORYSI Putative uncharacterized protein OS=Oryza... 82 1e-14
tr|Q8W2R4|Q8W2R4_ORYSA Putative RNA-binding protein OS=Oryza sat... 81 3e-14
tr|Q7XGR3|Q7XGR3_ORYSJ Os10g0151800 protein OS=Oryza sativa subs... 81 3e-14
tr|A9T0W7|A9T0W7_PHYPA Predicted protein OS=Physcomitrella paten... 79 2e-13
tr|B8BFR8|B8BFR8_ORYSI Putative uncharacterized protein OS=Oryza... 77 5e-13
tr|Q9ASP6|Q9ASP6_ARATH AT4g00830/A_TM018A10_14 (Putative unchara... 75 3e-12
tr|O23093|O23093_ARATH A_TM018A10.14 protein (Putative uncharact... 75 3e-12
tr|A7PPC6|A7PPC6_VITVI Chromosome chr8 scaffold_23, whole genome... 75 3e-12
tr|Q9LXJ8|Q9LXJ8_ARATH Putative RNA binding protein (At3g52660) ... 64 4e-09
tr|Q3E8X6|Q3E8X6_ARATH Uncharacterized protein At5g28390.1 OS=Ar... 63 1e-08
tr|A3C2L7|A3C2L7_ORYSJ Putative uncharacterized protein OS=Oryza... 58 3e-07
tr|Q9LKV2|Q9LKV2_ARATH F21B23.7 protein OS=Arabidopsis thaliana ... 57 5e-07
tr|Q2HS59|Q2HS59_MEDTR RNA-binding region RNP-1 (RNA recognition... 52 2e-05
tr|Q2RAS7|Q2RAS7_ORYSJ RNA recognition motif family protein, exp... 51 5e-05
tr|Q0IUR5|Q0IUR5_ORYSJ Os11g0139500 protein (Fragment) OS=Oryza ... 51 5e-05
tr|B7F699|B7F699_ORYSJ cDNA clone:J023003B09, full insert sequen... 51 5e-05
tr|A3C8G5|A3C8G5_ORYSJ Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|Q2QY16|Q2QY16_ORYSJ RNA recognition motif family protein, exp... 50 8e-05
tr|Q0IQ94|Q0IQ94_ORYSJ Os12g0136200 protein (Fragment) OS=Oryza ... 50 8e-05
tr|A3CER4|A3CER4_ORYSJ Putative uncharacterized protein OS=Oryza... 50 8e-05
tr|A2ZHW4|A2ZHW4_ORYSI Putative uncharacterized protein OS=Oryza... 50 8e-05
tr|Q84VA8|Q84VA8_ORYSJ Putative RNA-binding protein (Fragment) O... 49 1e-04
tr|A2ZB89|A2ZB89_ORYSI Putative uncharacterized protein OS=Oryza... 49 2e-04

>tr|Q2HTD6|Q2HTD6_MEDTR RNA-binding region RNP-1 (RNA recognition
motif); Calcium-binding EF-hand OS=Medicago truncatula
GN=MtrDRAFT_AC150443g37v2 PE=4 SV=2
Length = 559

Score = 90.9 bits (224), Expect = 4e-17
Identities = 48/91 (52%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
Frame = -1

Query: 549 NMYGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQSGTAV-APS 373
N+YG + G+ + QP+IYGRGP PAGM MVPM+LPDGRIGYVLQQ G V P
Sbjct: 469 NLYGSVGAGYGVAAAAAYQQPMIYGRGPMPAGMQMVPMVLPDGRIGYVLQQPGVQVPGPR 528

Query: 372 VSAYDREDRGGGRGPHSQKQAGN-SRRYNPY 283
DR + GGRG GN +RRY PY
Sbjct: 529 PRRNDRGNGPGGRGGGGGNDDGNRNRRYRPY 559


>tr|A7QFA8|A7QFA8_VITVI Chromosome undetermined scaffold_87, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00037346001 PE=4 SV=1
Length = 459

Score = 85.9 bits (211), Expect = 1e-15
Identities = 49/98 (50%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQSGTAVAPSVSA 364
YG + G+ G+ GF Q P+IYGRGPTPAGMAM+PM+LPDGRIGYVLQQ G S
Sbjct: 366 YGALGAGY-GTAGFAQ--PLIYGRGPTPAGMAMMPMLLPDGRIGYVLQQPGAQPHTPPSH 422

Query: 363 YDREDRGG-----------GRGPHSQKQAGNSRRYNPY 283
RGG RG H+ G+ RRY+PY
Sbjct: 423 QRSSGRGGSGSGSKSGGSSSRGRHN-NDGGHGRRYHPY 459


>tr|A9NVU4|A9NVU4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 506

Score = 84.7 bits (208), Expect = 3e-15
Identities = 53/106 (50%), Positives = 59/106 (55%), Gaps = 17/106 (16%)
Frame = -1

Query: 549 NMYGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQSGTAVAPSV 370
NMYG +MG++ QPVIYGRGPTP GM MVPM+LPDGR+GYVLQQ G AV S
Sbjct: 409 NMYGFGSMGYT--------QPVIYGRGPTPEGMTMVPMILPDGRVGYVLQQPGNAVGGSA 460

Query: 369 -------------SAYDREDR---GGGR-GPHSQKQAGNSRRYNPY 283
SA R R G GR G +G SRRY PY
Sbjct: 461 PYRSEGSASYGGGSASYRSSRTSSGSGRQGGGRNSGSGGSRRYRPY 506


>tr|A7PXS3|A7PXS3_VITVI Chromosome chr15 scaffold_37, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026153001
PE=4 SV=1
Length = 476

Score = 83.6 bits (205), Expect = 6e-15
Identities = 49/94 (52%), Positives = 54/94 (57%), Gaps = 5/94 (5%)
Frame = -1

Query: 549 NMYGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQSGTAVAPSV 370
N YG + G+ S F Q PVIYGRGP PAGM MVPM+LPDGRIGYVLQQ G + P
Sbjct: 385 NPYGSLGPGYGVSAPFQQ--PVIYGRGPMPAGMHMVPMVLPDGRIGYVLQQPGVQMPPPR 442

Query: 369 SAYDREDRGG----GRGPHSQKQAGN-SRRYNPY 283
+ G GRG S N SRRY PY
Sbjct: 443 PRRNERSNGSSGQQGRGGSSGSGDDNRSRRYRPY 476


>tr|B4F9N8|B4F9N8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 467

Score = 82.8 bits (203), Expect = 1e-14
Identities = 45/87 (51%), Positives = 50/87 (57%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQSGTAVAPSVSA 364
Y G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P
Sbjct: 386 YMGDPYGAYGGGGPAYNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGMPPPPPPR 445

Query: 363 YDREDRGGGRGPHSQKQAGNSRRYNPY 283
+ R GRG G+SRRY PY
Sbjct: 446 RGSDRRDSGRGGE-----GHSRRYRPY 467


>tr|Q53JL6|Q53JL6_ORYSJ RNA recognition motif family protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os11g14430 PE=4 SV=1
Length = 465

Score = 82.4 bits (202), Expect = 1e-14
Identities = 48/90 (53%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQ-SGTAVAPSVS 367
Y G G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P +
Sbjct: 383 YMGDPYGAYGGGGPGFNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGIPPPPPMR 442

Query: 366 AYDREDRG--GGRGPHSQKQAGNSRRYNPY 283
DR D G GG G H RRY PY
Sbjct: 443 RGDRRDGGSRGGEGSH-------GRRYRPY 465


>tr|Q0ITI7|Q0ITI7_ORYSJ Os11g0250000 protein OS=Oryza sativa subsp.
japonica GN=Os11g0250000 PE=4 SV=1
Length = 500

Score = 82.4 bits (202), Expect = 1e-14
Identities = 48/90 (53%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQ-SGTAVAPSVS 367
Y G G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P +
Sbjct: 418 YMGDPYGAYGGGGPGFNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGIPPPPPMR 477

Query: 366 AYDREDRG--GGRGPHSQKQAGNSRRYNPY 283
DR D G GG G H RRY PY
Sbjct: 478 RGDRRDGGSRGGEGSH-------GRRYRPY 500


>tr|A2ZD39|A2ZD39_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35702 PE=4 SV=1
Length = 468

Score = 82.4 bits (202), Expect = 1e-14
Identities = 48/90 (53%), Positives = 52/90 (57%), Gaps = 3/90 (3%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQ-SGTAVAPSVS 367
Y G G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P +
Sbjct: 386 YMGDPYGAYGGGGPGFNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGIPPPPPMR 445

Query: 366 AYDREDRG--GGRGPHSQKQAGNSRRYNPY 283
DR D G GG G H RRY PY
Sbjct: 446 RGDRRDGGSRGGEGSH-------GRRYRPY 468


>tr|Q8W2R4|Q8W2R4_ORYSA Putative RNA-binding protein OS=Oryza sativa
GN=OSJNBa0028C16.8 PE=4 SV=1
Length = 472

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/90 (53%), Positives = 51/90 (56%), Gaps = 3/90 (3%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQ-SGTAVAPSVS 367
Y G G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P
Sbjct: 390 YMGDPYGAYGGGGPGFNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGIPPPPPPR 449

Query: 366 AYDREDRG--GGRGPHSQKQAGNSRRYNPY 283
DR D G GG G H RRY PY
Sbjct: 450 RGDRRDGGSRGGEGSH-------GRRYRPY 472


>tr|Q7XGR3|Q7XGR3_ORYSJ Os10g0151800 protein OS=Oryza sativa subsp.
japonica GN=Os10g0151800 PE=4 SV=1
Length = 472

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/90 (53%), Positives = 51/90 (56%), Gaps = 3/90 (3%)
Frame = -1

Query: 543 YGGMAMGFSGSRGFGQVQPVIYGRGPTPAGMAMVPMMLPDGRIGYVLQQ-SGTAVAPSVS 367
Y G G G G G QP+IYGRGP PAGM MVPM+LPDGR+GYVLQQ G P
Sbjct: 390 YMGDPYGAYGGGGPGFNQPMIYGRGPAPAGMRMVPMVLPDGRLGYVLQQPGGIPPPPPPR 449

Query: 366 AYDREDRG--GGRGPHSQKQAGNSRRYNPY 283
DR D G GG G H RRY PY
Sbjct: 450 RGDRRDGGSRGGEGSH-------GRRYRPY 472