BP915510
Clone id YMU001_000072_E02
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000072_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAAGTGATAGAGTCTTGCCAATCCAATCTCAAGTAGCTGCTGCTCCTATTGATACCAAG
AAAAGGCATGCGCCCAATTCAGTTCAGAGTGTGGTATCACGGCGGCTTAAAATCGTCGGC
GTCAAGTCTGATAACGGAGCTCAGAAACTGGCTCAATCAACAAAATCATTAAAGCCAACA
CAAATCAGTGGTGCTTCACAATGGCAAGGTTTGGTTGGATATGGGAGCGATGACAGTGAT
GATGATGATGGTCCGGGAGGCGCTCCAGGCTGATCATTAAATCAAATTGGACTTGCAGAC
GATGGCTTGGGAAGTCCTAACCTTTCAGCAGATTGTCGCTTGTAAGAAGTCCCTATCAGA
TTCGATGGGGATTTTGGTTAATGCGAACTTTTTGCCCACATGCAAAATTATGGGGAAGTT
CCATCTTAGCTTCTAGTATCTACGCCTTGTATGTATGATGCAAGCTACTAGGCATTTTTT
ACCCTCGTGCTGCCGAATGTAAATGGTAATCCATCTAG
■■Homology search results ■■ -
sp_hit_id Q9LN77
Definition sp|Q9LN77|P2A12_ARATH F-box protein PP2-A12 OS=Arabidopsis thaliana
Align length 30
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915510|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_E02.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LN77|P2A12_ARATH F-box protein PP2-A12 OS=Arabidopsis thali... 32 2.3
sp|Q313W7|CNPD_DESDG 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 30 5.2
sp|Q8T1C6|GNT1_DICDI [Skp1-protein]-hydroxyproline N-acetylgluco... 30 6.8

>sp|Q9LN77|P2A12_ARATH F-box protein PP2-A12 OS=Arabidopsis thaliana
GN=P2A12 PE=2 SV=1
Length = 291

Score = 31.6 bits (70), Expect = 2.3
Identities = 10/30 (33%), Positives = 21/30 (70%)
Frame = +2

Query: 68 MRPIQFRVWYHGGLKSSASSLITELRNWLN 157
++P++F++W G SS+ ++TE NW++
Sbjct: 209 IKPVRFQLWTEDGQYSSSQCMLTERGNWIH 238


>sp|Q313W7|CNPD_DESDG 2',3'-cyclic-nucleotide 2'-phosphodiesterase
OS=Desulfovibrio desulfuricans (strain G20) GN=Dde_0978
PE=3 SV=2
Length = 519

Score = 30.4 bits (67), Expect = 5.2
Identities = 16/45 (35%), Positives = 28/45 (62%)
Frame = +1

Query: 58 KKRHAPNSVQSVVSRRLKIVGVKSDNGAQKLAQSTKSLKPTQISG 192
+K H SV+ ++RR + +G+K + QK+A+ K L+ +ISG
Sbjct: 106 QKEHDALSVEKELNRRERTLGLKEEELTQKIAEQDKKLQ--EISG 148


>sp|Q8T1C6|GNT1_DICDI [Skp1-protein]-hydroxyproline
N-acetylglucosaminyltransferase OS=Dictyostelium
discoideum GN=gnt1 PE=1 SV=2
Length = 423

Score = 30.0 bits (66), Expect = 6.8
Identities = 11/36 (30%), Positives = 21/36 (58%)
Frame = +2

Query: 308 WEVLTFQQIVACKKSLSDSMGILVNANFLPTCKIMG 415
W++ Q++ CKK D+ G++++ + TC MG
Sbjct: 111 WDIEMINQLLQCKKPNDDNGGMVIDEKAILTCYPMG 146


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915510|Adiantum capillus-veneris mRNA, clone:
YMU001_000072_E02.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******