BP915555
Clone id YMU001_000073_A05
Library
Length 516
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAGCACTGCCCAGATGGGCTGAGTATATGTCTTTATGTTTTGTGACTGCATCTATGTCA
TTTGCATAGCATTTTGTGAAGCACATGAATCTAATGCATCGAGTTCCAACTTGGATGAGA
TAGATAGATCTCACAAAGATGAGATGGTTGGATAGAAATTTGATTGTAGCACTATATGGT
GTGATGCATACTAGAGAACCTATTGTTTGGTGTTGATCGTCATTGGCGTGTATGAATAAA
GGCAATGTCTGTTCAAGAACCGAATTGACTTTTTGCAAGTGTAATCGCGGGCGATTACTC
TTCGTTTAAAGAGGGGTATGTCATAAAGCGATGATGTGGCATCTCAATAGAAGAGGAGAG
ATAAAAAATCACCAATGACGACGTGGCTATATTGCCCTAGCACAAAATATGACGGGAAAT
CTGGGCTATTGGCATGGCAAATATTACAATTTTCAAGAAGTTTCTTAGCGTACACTTTTG
AATGCAATAGCAATGATTTGTTTTTTATGCTTTTCA
■■Homology search results ■■ -
sp_hit_id Q618G2
Definition sp|Q618G2|C25HL_CAEBR Cholesterol 25-hydroxylase-like protein OS=Caenorhabditis briggsae
Align length 87
Score (bit) 32.0
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915555|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_A05.
(516 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q618G2|C25HL_CAEBR Cholesterol 25-hydroxylase-like protein OS... 32 1.8
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN... 30 8.7
sp|Q5RCC7|MSPD1_PONAB Motile sperm domain-containing protein 1 O... 30 8.7
sp|Q8VEL0|MSPD1_MOUSE Motile sperm domain-containing protein 1 O... 30 8.7
sp|Q9UJG1|MSPD1_HUMAN Motile sperm domain-containing protein 1 O... 30 8.7

>sp|Q618G2|C25HL_CAEBR Cholesterol 25-hydroxylase-like protein
OS=Caenorhabditis briggsae GN=CBG14675 PE=3 SV=1
Length = 300

Score = 32.0 bits (71), Expect = 1.8
Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 6/87 (6%)
Frame = -3

Query: 457 LENCNICHANSPDFPSYFVLG-QYSHVVIGDFLSLLFY*DATSSLYDIPLFKRRVIARDY 281
++N N +SP FP ++ L Y+ V + F+ L LYD+P FK I +D
Sbjct: 31 IKNGNEHILSSPLFPPFYALSIDYTWVAVFTFIDLF--------LYDVPFFKNAKIQKDR 82

Query: 280 T-----CKKSIRFLNRHCLYSYTPMTI 215
KKS++ + L PM +
Sbjct: 83 VVTWDLMKKSLKLQGWNQLLWIYPMAL 109


>sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens
GN=ZNF341 PE=2 SV=2
Length = 854

Score = 29.6 bits (65), Expect = 8.7
Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = -3

Query: 505 KNKSLLLHSKVYAKKLLENCNICHANSPDFPSYFVLG--QYSHVVI 374
K + L H K + ++L C++C DFPS + LG QYSH ++
Sbjct: 486 KLDTFLEHIKSHQEELSYRCHLC---GKDFPSLYDLGVHQYSHSLL 528


>sp|Q5RCC7|MSPD1_PONAB Motile sperm domain-containing protein 1
OS=Pongo abelii GN=MOSPD1 PE=2 SV=1
Length = 213

Score = 29.6 bits (65), Expect = 8.7
Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)
Frame = -2

Query: 284 LHLQKVN-SVLEQTLPLFIHAN------DDQHQTIGSLVCITPYSATIKFLSNHLIFVRS 126
+H QK ++E LP+F+ DDQ L PY +KF L +
Sbjct: 1 MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKF--KVLCTTPN 58

Query: 125 IYLIQVGTRCIRFMCFTKCYANDIDAVTKHKDIYSAHLG 9
Y++ ++ C +D V +H+D+ S H G
Sbjct: 59 KYVVVNAAGAVKPQCC-------VDIVIRHRDVRSCHYG 90


>sp|Q8VEL0|MSPD1_MOUSE Motile sperm domain-containing protein 1
OS=Mus musculus GN=Mospd1 PE=2 SV=1
Length = 213

Score = 29.6 bits (65), Expect = 8.7
Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)
Frame = -2

Query: 284 LHLQKVN-SVLEQTLPLFIHAN------DDQHQTIGSLVCITPYSATIKFLSNHLIFVRS 126
+H QK ++E LP+F+ DDQ L PY +KF L +
Sbjct: 1 MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKF--KVLCTTPN 58

Query: 125 IYLIQVGTRCIRFMCFTKCYANDIDAVTKHKDIYSAHLG 9
Y++ ++ C +D V +H+D+ S H G
Sbjct: 59 KYVVVDAAGAVKPQCC-------VDIVIRHRDVRSCHYG 90


>sp|Q9UJG1|MSPD1_HUMAN Motile sperm domain-containing protein 1
OS=Homo sapiens GN=MOSPD1 PE=2 SV=1
Length = 213

Score = 29.6 bits (65), Expect = 8.7
Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)
Frame = -2

Query: 284 LHLQKVN-SVLEQTLPLFIHAN------DDQHQTIGSLVCITPYSATIKFLSNHLIFVRS 126
+H QK ++E LP+F+ DDQ L PY +KF L +
Sbjct: 1 MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKF--KVLCTTPN 58

Query: 125 IYLIQVGTRCIRFMCFTKCYANDIDAVTKHKDIYSAHLG 9
Y++ ++ C +D V +H+D+ S H G
Sbjct: 59 KYVVVDAAGAVKPQCC-------VDIVIRHRDVRSCHYG 90


tr_hit_id B6Y5C7
Definition tr|B6Y5C7|B6Y5C7_ANATH Putative uncharacterized protein OS=Anaerocellum thermophilum DSM 6725
Align length 106
Score (bit) 35.8
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915555|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_A05.
(516 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6Y5C7|B6Y5C7_ANATH Putative uncharacterized protein OS=Anaer... 36 1.3
tr|Q9SCJ2|Q9SCJ2_ARBUN NADH dehydrogenase subunit F (Fragment) O... 35 2.2
tr|Q5ZK52|Q5ZK52_CHICK Putative uncharacterized protein OS=Gallu... 33 8.3
tr|Q98LW8|Q98LW8_RHILO Mlr0842 protein OS=Rhizobium loti GN=mlr0... 33 8.3

>tr|B6Y5C7|B6Y5C7_ANATH Putative uncharacterized protein
OS=Anaerocellum thermophilum DSM 6725 GN=AtheDRAFT_2680
PE=4 SV=1
Length = 230

Score = 35.8 bits (81), Expect = 1.3
Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 14/106 (13%)
Frame = -2

Query: 287 RLHLQKVNSVLEQT----LPLFIHANDDQHQTIGSLVCITPYSATIKFLSNHLIFVRSIY 120
+LH++K+NS LE+ +PL + D + SL C T YS K L IFV+ I
Sbjct: 91 KLHIKKLNSELEEEDIIDIPLLLELEDFDN----SLFCKTKYSIHAKLLDKRYIFVKLIP 146

Query: 119 LIQVGTRCIRF--------MCFTKCY--ANDIDAVTKHKDIYSAHL 12
+ + RF + K Y ++ + KH D+ HL
Sbjct: 147 YLGKKDQLERFEPLFVFIDIIAKKYYLLSSRLSKKIKHIDVVQVHL 192


>tr|Q9SCJ2|Q9SCJ2_ARBUN NADH dehydrogenase subunit F (Fragment)
OS=Arbutus unedo GN=ndhF PE=4 SV=1
Length = 697

Score = 35.0 bits (79), Expect = 2.2
Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 5/60 (8%)
Frame = -3

Query: 475 VYAKKLLENCNICHANSPDFPSYFVLGQY-----SHVVIGDFLSLLFY*DATSSLYDIPL 311
+ +K L + N+ H NS +FP + GQY S G F++L FY SS ++ L
Sbjct: 566 ILSKWLTPSINLLHPNSKNFPDWSEFGQYAIFSVSIAYFGIFIALFFYKPVYSSFQNLEL 625


>tr|Q5ZK52|Q5ZK52_CHICK Putative uncharacterized protein OS=Gallus
gallus GN=RCJMB04_13c20 PE=2 SV=1
Length = 576

Score = 33.1 bits (74), Expect = 8.3
Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%)
Frame = -3

Query: 505 KNKSLLLHSKVYAKKLLENCNICHANSPDFPSYFVLG--QYSHVVI 374
K +S L H K + ++L C++C S DFPS + LG QYSH ++
Sbjct: 477 KLESFLDHIKSHQEELSYRCHLC---SKDFPSLYELGVHQYSHSLL 519


>tr|Q98LW8|Q98LW8_RHILO Mlr0842 protein OS=Rhizobium loti GN=mlr0842
PE=4 SV=1
Length = 150

Score = 33.1 bits (74), Expect = 8.3
Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%)
Frame = -3

Query: 463 KLLENCNIC-----HANSPDFPSYFVLGQYSHVVIGDFLSLLFY*DATSSL 326
K ++ C++C H + D P+Y V+ H+V+G F+ + +ATS+L
Sbjct: 51 KTVDTCSVCGEEIHHHRADDLPAYLVIVIVGHIVLGAFMGV----EATSTL 97