BP915559
Clone id YMU001_000073_A09
Library
Length 355
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAATAAAGATACACCGGTATTACTAGAAGAGAGACCATTAAGACTAGCAAAGAATCTGTG
CATAATAAGTTCCCTCAGACGCAGACAATTGCTCCATGACATACTAATCTAAACTGAAGA
AAGGCAGCTGTGGTCCTAACTCTAGAGCCCATCAGCTTACAGCTCCTAGATGAGTAACTG
TTTATTGCAAAACTGATGTATATATATGTGTGCCTAATTGGCTGATCTTGTCGAGCAATA
TACAAAGAAGTTATAAAAATTCCCTAGTGCTCTGTTTAAGAATAGACTCATGAATATGGA
AGGATGAGCCCTATGTCTGAGTGATGATTCTCAGAAGATGTTATACAAATAACTC
■■Homology search results ■■ -
sp_hit_id Q09FY8
Definition sp|Q09FY8|YCF1_PLAOC Putative membrane protein ycf1 OS=Platanus occidentalis
Align length 61
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915559|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_A09.
(355 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q09FY8|YCF1_PLAOC Putative membrane protein ycf1 OS=Platanus ... 30 2.9
sp|A0A393|YCF1_COFAR Putative membrane protein ycf1 OS=Coffea ar... 29 8.5

>sp|Q09FY8|YCF1_PLAOC Putative membrane protein ycf1 OS=Platanus
occidentalis GN=ycf1 PE=3 SV=1
Length = 1915

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/61 (29%), Positives = 29/61 (47%)
Frame = -2

Query: 351 YLYNIF*ESSLRHRAHPSIFMSLFLNRALGNFYNFFVYCSTRSAN*AHIYIHQFCNKQLL 172
Y NI S++R+ +FLN + +N F+ S+ A +IY+ Q NK L
Sbjct: 109 YFLNINYGSTIRNSIRNLNIQCVFLNNLIFPLFNHFILPSSTLARLINIYMFQCNNKMLF 168

Query: 171 I 169
+
Sbjct: 169 V 169


>sp|A0A393|YCF1_COFAR Putative membrane protein ycf1 OS=Coffea
arabica GN=ycf1 PE=3 SV=1
Length = 1874

Score = 28.9 bits (63), Expect = 8.5
Identities = 13/39 (33%), Positives = 22/39 (56%)
Frame = -2

Query: 285 LFLNRALGNFYNFFVYCSTRSAN*AHIYIHQFCNKQLLI 169
+FLN + +N+F+ S+ A +IYI + NK L +
Sbjct: 129 VFLNNLIFQLFNYFILPSSMLARLVNIYIFRCNNKMLFV 167


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915559|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_A09.
(355 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******