BP915579
Clone id YMU001_000073_C07
Library
Length 297
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_C07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGAAACATGTAAAGTGTACAGAGTTCCTGACTTTCTGCCATGTGCTACAGTCATCGAAC
CTTTGGAGATCCTTCAAGCGTTGTTCCCAAAAACTGTCACATAACCCGCATCATCCAACT
TCCCTGTACTAATCAAGCTCTTTCGGATTGCTGGAACATATCTGACATTCTTGAGCCATA
AAGAAGAGCCATTCTGAAACTTCAACTGCACATCTCCCACTCCAAGTATGTCACAAACCT
GCTCATTGCCAAGTCTGACTTAATCTTTAGTAGCCACATATGATGTAAACCACTCTT
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 81
Score (bit) 69.7
E-value 4.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915579|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_C07.
(297 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 70 4e-12
sp|P87293|YDN1_SCHPO Uncharacterized protein C16A10.01 OS=Schizo... 30 5.0
sp|Q07TX5|DAPD_RHOP5 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat... 29 6.5

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 69.7 bits (169), Expect = 4e-12
Identities = 36/81 (44%), Positives = 51/81 (62%)
Frame = -3

Query: 259 VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGKLDDAGYVTVFGNN 80
V++GN I G+GD+ +K G +L LK+VR+VP +R +LIS LD GY + F N
Sbjct: 322 VKMGNTSYSKIAGIGDICIKTNVGCTLVLKDVRHVPDLRMNLISGIALDRDGYESYFANQ 381

Query: 79 A*RISKGSMTVAHGRKSGTLY 17
R++KGS+ +A G GTLY
Sbjct: 382 KWRLTKGSLVIAKGVARGTLY 402


>sp|P87293|YDN1_SCHPO Uncharacterized protein C16A10.01
OS=Schizosaccharomyces pombe GN=SPAC16A10.01 PE=2 SV=1
Length = 830

Score = 29.6 bits (65), Expect = 5.0
Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
Frame = +2

Query: 38 AMCYSHRTFGDPSSVVPKNCHI-TRIIQLPCTNQALSDC 151
A+C + +G PS + ++ I +RI+QLP T L DC
Sbjct: 401 AVCEAMMLYGSPSHKIQQSLRIASRILQLPATFLYLPDC 439


>sp|Q07TX5|DAPD_RHOP5 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
N-succinyltransferase OS=Rhodopseudomonas palustris
(strain BisA53) GN=dapD PE=3 SV=1
Length = 281

Score = 29.3 bits (64), Expect = 6.5
Identities = 18/59 (30%), Positives = 32/59 (54%)
Frame = -3

Query: 286 TSYVATKD*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGKLDD 110
T ATK VR EQ D+L G+V++ + S W+ N ++K+++ + +L+D
Sbjct: 19 TVSAATKGEVRDAVEQALDLLDKGEVRVAAREASGAWVVN----QWLKKAVLLSFRLND 73


tr_hit_id A5C9D7
Definition tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 96
Score (bit) 87.8
E-value 2.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915579|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_C07.
(297 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis... 88 2e-16
tr|A5B4R8|A5B4R8_VITVI Putative uncharacterized protein OS=Vitis... 87 3e-16
tr|Q5MG99|Q5MG99_IPOBA Hypothetical retrotransposon OS=Ipomoea b... 86 1e-15
tr|A5AJI7|A5AJI7_VITVI Putative uncharacterized protein OS=Vitis... 85 2e-15
tr|A5C540|A5C540_VITVI Putative uncharacterized protein OS=Vitis... 85 2e-15
tr|A5B9T5|A5B9T5_VITVI Putative uncharacterized protein OS=Vitis... 81 2e-14
tr|A5C2E5|A5C2E5_VITVI Putative uncharacterized protein OS=Vitis... 80 4e-14
tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis... 79 1e-13
tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis... 78 2e-13
tr|A5BEP3|A5BEP3_VITVI Putative uncharacterized protein OS=Vitis... 77 4e-13
tr|A5BAF2|A5BAF2_VITVI Putative uncharacterized protein OS=Vitis... 77 4e-13
tr|A5BQG4|A5BQG4_VITVI Putative uncharacterized protein OS=Vitis... 77 6e-13
tr|A5AIP8|A5AIP8_VITVI Putative uncharacterized protein OS=Vitis... 77 6e-13
tr|A5B377|A5B377_VITVI Putative uncharacterized protein OS=Vitis... 76 7e-13
tr|A5B2M3|A5B2M3_VITVI Putative uncharacterized protein OS=Vitis... 76 7e-13
tr|A5AN26|A5AN26_VITVI Putative uncharacterized protein OS=Vitis... 76 7e-13
tr|A5BD56|A5BD56_VITVI Putative uncharacterized protein OS=Vitis... 75 1e-12
tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5AM64|A5AM64_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|Q9ZRJ0|Q9ZRJ0_TOBAC Retrotransposon Tto1 DNA OS=Nicotiana tab... 75 2e-12
tr|A7R7G1|A7R7G1_VITVI Chromosome undetermined scaffold_1754, wh... 75 2e-12
tr|A7QG92|A7QG92_VITVI Chromosome undetermined scaffold_91, whol... 75 2e-12
tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5BPB3|A5BPB3_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5BGX3|A5BGX3_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5BA89|A5BA89_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5B0C8|A5B0C8_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5AQN2|A5AQN2_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A5BWL7|A5BWL7_VITVI Putative uncharacterized protein OS=Vitis... 74 3e-12

>tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007304 PE=4 SV=1
Length = 1362

Score = 87.8 bits (216), Expect = 2e-16
Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 1/96 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++FTSY + VR+GN+ +G+GDV+L+ NG+ L LKNV+++P IR +LISTGK
Sbjct: 286 DFFTSYTSGDFGSVRMGNDGSAKAIGMGDVRLETSNGTMLTLKNVKHIPDIRMNLISTGK 345

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTL 11
LDD G+ F ++ ++++GSM +A G KS +LY +
Sbjct: 346 LDDEGFCNTFRDSQWKLTRGSMVIAKGNKSSSLYLM 381


>tr|A5B4R8|A5B4R8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018405 PE=4 SV=1
Length = 1302

Score = 87.4 bits (215), Expect = 3e-16
Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 1/96 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++FTSY + VR+GN+ +G+GDV+L+ NG+ L LKNV+++P IR +LISTGK
Sbjct: 173 DFFTSYTSGDFGSVRMGNDGSAKAIGMGDVRLETSNGTMLTLKNVKHIPDIRMNLISTGK 232

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTL 11
LDD G+ F ++ ++++GSM +A G KS +LY +
Sbjct: 233 LDDEGFXNTFRDSQWKLTRGSMXIAKGNKSSSLYLM 268


>tr|Q5MG99|Q5MG99_IPOBA Hypothetical retrotransposon OS=Ipomoea
batatas PE=4 SV=1
Length = 1415

Score = 85.5 bits (210), Expect = 1e-15
Identities = 47/99 (47%), Positives = 63/99 (63%), Gaps = 1/99 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
E+FTSY +R+GN+ + G G V L+ NG+ L LKNV++ P IR +LISTGK
Sbjct: 304 EFFTSYTPGDFGELRMGNDGQVKVTGTGTVCLETSNGTKLVLKNVKHAPDIRLNLISTGK 363

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTLHVS 2
LDD G+ FG+ +I+KGS+ VA G KS LY+L S
Sbjct: 364 LDDDGFCCFFGDGHWKITKGSLVVARGNKSSNLYSLQSS 402


>tr|A5AJI7|A5AJI7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038145 PE=4 SV=1
Length = 579

Score = 85.1 bits (209), Expect = 2e-15
Identities = 45/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
Frame = -3

Query: 295 EWFTSYV-ATKD*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++F+SY + V +GNE C+I+G+GDV L+ G L LK+VR+VP +R SLIS GK
Sbjct: 183 DFFSSYTNGSFGWVXMGNEAKCEIVGMGDVDLETXIGCKLVLKDVRHVPXMRFSLISVGK 242

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTLHV 5
LDD GY + G +I+KGS+ + G+K+ TLY + V
Sbjct: 243 LDDEGYHSHLGEGKWKITKGSLVLXRGKKNNTLYKIEV 280


>tr|A5C540|A5C540_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024474 PE=4 SV=1
Length = 1207

Score = 84.7 bits (208), Expect = 2e-15
Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 1/96 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++FTSY + VR+GN+ +G+ +V+L+ NG+ L LKNV+++P IR +LISTGK
Sbjct: 189 DFFTSYTSGDFGSVRMGNDDSAKAIGMRNVRLETSNGTMLTLKNVKHIPDIRMNLISTGK 248

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTL 11
LDD G+ +F ++ ++++GSM +A G KS +LY +
Sbjct: 249 LDDEGFYNIFRDSQWKLTRGSMVIAKGNKSSSLYLM 284


>tr|A5B9T5|A5B9T5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030853 PE=4 SV=1
Length = 1017

Score = 81.3 bits (199), Expect = 2e-14
Identities = 41/98 (41%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++FTSY + VR+GN+ + +G+GDV+L+ NG+ L LKNV+++P IR +LIST K
Sbjct: 60 DFFTSYTFSDFGSVRMGNDGLAKAIGMGDVRLETSNGTMLTLKNVKHIPDIRMNLISTRK 119

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTLHV 5
LDD G F ++ ++++GSM + KS +LY + V
Sbjct: 120 LDDEGLCNTFRDSQWKLTRGSMVITKENKSSSLYLMQV 157


>tr|A5C2E5|A5C2E5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029099 PE=4 SV=1
Length = 649

Score = 80.5 bits (197), Expect = 4e-14
Identities = 41/99 (41%), Positives = 65/99 (65%), Gaps = 1/99 (1%)
Frame = -3

Query: 295 EWFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGK 119
++FTSY + VR+GN+ +G+GDV L+ NG L LKNV+++P I +LISTGK
Sbjct: 262 DFFTSYTSGDFGSVRMGNDGSAKAIGMGDVHLETSNGIVLILKNVKHIPDISMNLISTGK 321

Query: 118 LDDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTLHVS 2
LD+ G+ F ++ ++++GSM +A G+K +LY + S
Sbjct: 322 LDNEGFCNTFRDSQWKLTRGSMVIAKGKKCSSLYFMQES 360


>tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018181 PE=4 SV=1
Length = 1069

Score = 79.0 bits (193), Expect = 1e-13
Identities = 35/81 (43%), Positives = 55/81 (67%)
Frame = -3

Query: 259 VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGKLDDAGYVTVFGNN 80
V L N D++G+GDVQ+ NGS L+ VR++P +R++LIS G+LDD G+ +F
Sbjct: 314 VYLANNSTLDVVGLGDVQISLXNGSVWLLEKVRHIPDLRRNLISVGQLDDEGHAILFVGG 373

Query: 79 A*RISKGSMTVAHGRKSGTLY 17
+++KG+ +A G+K+GTLY
Sbjct: 374 TWKVTKGARVLARGKKTGTLY 394


>tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024659 PE=4 SV=1
Length = 1287

Score = 77.8 bits (190), Expect = 2e-13
Identities = 34/81 (41%), Positives = 56/81 (69%)
Frame = -3

Query: 259 VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGKLDDAGYVTVFGNN 80
V L + D++G+GDV++ NGS L+ VR++P +R++LIS G+LDD G+ +F
Sbjct: 314 VYLADGSALDVVGLGDVRISLPNGSVWLLEKVRHIPDLRRNLISVGQLDDEGHAILFVGG 373

Query: 79 A*RISKGSMTVAHGRKSGTLY 17
+++KG+ +AHG+K+GTLY
Sbjct: 374 TWKVTKGARVLAHGKKTGTLY 394


>tr|A5BEP3|A5BEP3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004522 PE=4 SV=1
Length = 882

Score = 77.0 bits (188), Expect = 4e-13
Identities = 40/95 (42%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
Frame = -3

Query: 292 WFTSYVATK-D*VRLGNEQVCDILGVGDVQLKFQNGSSLWLKNVRYVPAIRKSLISTGKL 116
+FTSY + VR+GN+ + +G+ DV+L+ NG+ L LKNV+++P IR +LIS GKL
Sbjct: 176 FFTSYTSDDFGSVRMGNDDLAKAIGMRDVRLETSNGTMLILKNVKHIPDIRMNLISIGKL 235

Query: 115 DDAGYVTVFGNNA*RISKGSMTVAHGRKSGTLYTL 11
DD G F ++ ++++GSM VA +K +LY +
Sbjct: 236 DDEGLYNTFLDSQWKLTRGSMVVAKRKKYSSLYLM 270