BP915595
Clone id YMU001_000073_D12
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_D12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATGGATCAAGATGCTCTTGCTGCTCACGGGCCCCTTGCTTTTGATTCACCTGCTTATGG
TTGCAAGCTCTTTTGATCGCTCAATTCTCTCTTGCAATGCAAACCTCTAGTACTCCTGCC
GACATATCCGGATTTCTTGCAGAGTCTTGCCAAGCTCCTGAAATCTCGATAGGGGTCGCT
TCGTGCGTGGCTAGCCGGGGCTCGCGGTAGGATGTGCGGAGCTATGATACCAATTGATGG
TGTTGATGCGGAGTGTGCAAGAGAGGGAAGGAGAAGGGGGAAGGGCAGAACAGATTATGT
TAGTGGAGCTTGTGAGAGAATTTCTCTCACTCCTTATTATCTATAAGAAACAAAAAAAAA
GTGGACTGTTGCCCGCCCGGTCATAACCGGCCTGCATGGGCCTGAATCTAACAAGGTATG
GCTTGCATGGGCCTGAACCTAACAAGGTATGGCTTGCTTATTTGACACAGTTTAAAAGTA
GCTTTTATGCTATTGCTTATGTGTTTGATGCTTATTTAGAACTAATTTTGTACTTGGTGG
GACATC
■■Homology search results ■■ -
sp_hit_id P02694
Definition sp|P02694|RET1_BOVIN Retinol-binding protein 1 OS=Bos taurus
Align length 39
Score (bit) 32.3
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915595|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_D12.
(546 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P02694|RET1_BOVIN Retinol-binding protein 1 OS=Bos taurus GN=... 32 1.5
sp|P02696|RET1_RAT Retinol-binding protein 1 OS=Rattus norvegicu... 31 3.4
sp|Q00915|RET1_MOUSE Retinol-binding protein 1 OS=Mus musculus G... 31 3.4
sp|P09455|RET1_HUMAN Retinol-binding protein 1 OS=Homo sapiens G... 31 3.4
sp|Q8XVI7|MURG_RALSO UDP-N-acetylglucosamine--N-acetylmuramyl-(p... 31 4.4
sp|P0C5G8|TRA9_MYCTU Putative transposase for insertion sequence... 30 5.8
sp|A5TY79|TRA9_MYCTA Putative transposase for insertion sequence... 30 5.8
sp|P59800|TRA9_MYCBO Putative transposase for insertion sequence... 30 5.8
sp|A1WYU3|MURG_HALHL UDP-N-acetylglucosamine--N-acetylmuramyl-(p... 30 5.8
sp|O60008|HSP60_PARBR Heat shock protein 60, mitochondrial OS=Pa... 30 5.8
sp|Q66JN8|CA089_DANRE Miro domain-containing protein C1orf89 hom... 30 7.6
sp|Q87FK3|ARAA_VIBPA L-arabinose isomerase OS=Vibrio parahaemoly... 30 7.6

>sp|P02694|RET1_BOVIN Retinol-binding protein 1 OS=Bos taurus
GN=RBP1 PE=1 SV=4
Length = 135

Score = 32.3 bits (72), Expect = 1.5
Identities = 13/39 (33%), Positives = 20/39 (51%)
Frame = +2

Query: 191 LAGARGRMCGAMIPIDGVDAECAREGRRRGKGRTDYVSG 307
L G R C + DG EC ++G + G+G T ++ G
Sbjct: 75 LTGIDDRKCMTTVSWDGDKLECVQKGEKEGRGWTQWIEG 113


>sp|P02696|RET1_RAT Retinol-binding protein 1 OS=Rattus norvegicus
GN=Rbp1 PE=1 SV=2
Length = 135

Score = 31.2 bits (69), Expect = 3.4
Identities = 12/39 (30%), Positives = 20/39 (51%)
Frame = +2

Query: 191 LAGARGRMCGAMIPIDGVDAECAREGRRRGKGRTDYVSG 307
L G R C + DG +C ++G + G+G T ++ G
Sbjct: 75 LTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEG 113


>sp|Q00915|RET1_MOUSE Retinol-binding protein 1 OS=Mus musculus
GN=Rbp1 PE=2 SV=2
Length = 135

Score = 31.2 bits (69), Expect = 3.4
Identities = 12/39 (30%), Positives = 20/39 (51%)
Frame = +2

Query: 191 LAGARGRMCGAMIPIDGVDAECAREGRRRGKGRTDYVSG 307
L G R C + DG +C ++G + G+G T ++ G
Sbjct: 75 LTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEG 113


>sp|P09455|RET1_HUMAN Retinol-binding protein 1 OS=Homo sapiens
GN=RBP1 PE=1 SV=2
Length = 135

Score = 31.2 bits (69), Expect = 3.4
Identities = 12/39 (30%), Positives = 20/39 (51%)
Frame = +2

Query: 191 LAGARGRMCGAMIPIDGVDAECAREGRRRGKGRTDYVSG 307
L G R C + DG +C ++G + G+G T ++ G
Sbjct: 75 LTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEG 113


>sp|Q8XVI7|MURG_RALSO
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
pyrophosphoryl-undecaprenol N-acetylglucosamine
transferase OS=Ralstonia solanacearum GN=murG PE=3 SV=1
Length = 365

Score = 30.8 bits (68), Expect = 4.4
Identities = 21/48 (43%), Positives = 26/48 (54%)
Frame = +2

Query: 143 SLAKLLKSR*GSLRAWLAGARGRMCGAMIPIDGVDAECAREGRRRGKG 286
S+A+LL +R G WL A G M G ++P G E R G RGKG
Sbjct: 29 SVARLLAAR-GWQVVWLGNASG-MEGQLVPKHGFPLESVRFGGVRGKG 74


>sp|P0C5G8|TRA9_MYCTU Putative transposase for insertion sequence
element IS986/IS6110 OS=Mycobacterium tuberculosis
GN=Rv0796 PE=4 SV=1
Length = 278

Score = 30.4 bits (67), Expect = 5.8
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
Frame = +3

Query: 372 PARS*PACMGLNLTRYGLHGPEPNKVWLAYLTQFK--SSFYAIAYVFDAYLELIL 530
PA + PA +L + P PN++W+A LT + F +A+V DAY IL
Sbjct: 87 PATARPA----DLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRIL 137


>sp|A5TY79|TRA9_MYCTA Putative transposase for insertion sequence
element IS986/IS6110 OS=Mycobacterium tuberculosis
(strain ATCC 25177 / H37Ra) GN=MRA_0011 PE=3 SV=2
Length = 278

Score = 30.4 bits (67), Expect = 5.8
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
Frame = +3

Query: 372 PARS*PACMGLNLTRYGLHGPEPNKVWLAYLTQFK--SSFYAIAYVFDAYLELIL 530
PA + PA +L + P PN++W+A LT + F +A+V DAY IL
Sbjct: 87 PATARPA----DLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRIL 137


>sp|P59800|TRA9_MYCBO Putative transposase for insertion sequence
element IS986/IS6110 OS=Mycobacterium bovis GN=Mb2838c
PE=3 SV=1
Length = 278

Score = 30.4 bits (67), Expect = 5.8
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
Frame = +3

Query: 372 PARS*PACMGLNLTRYGLHGPEPNKVWLAYLTQFK--SSFYAIAYVFDAYLELIL 530
PA + PA +L + P PN++W+A LT + F +A+V DAY IL
Sbjct: 87 PATARPA----DLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTDAYARRIL 137


>sp|A1WYU3|MURG_HALHL
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
pyrophosphoryl-undecaprenol N-acetylglucosamine
transferase OS=Halorhodospira halophila (strain DSM 244
/ SL1) GN=murG PE=3 SV=1
Length = 358

Score = 30.4 bits (67), Expect = 5.8
Identities = 19/48 (39%), Positives = 26/48 (54%)
Frame = +2

Query: 143 SLAKLLKSR*GSLRAWLAGARGRMCGAMIPIDGVDAECAREGRRRGKG 286
++A L+ R G WL G R + G ++P G+DAE G RGKG
Sbjct: 22 AVADALRER-GHRVVWL-GTRAGLEGRVVPAAGLDAEWLEIGGMRGKG 67


>sp|O60008|HSP60_PARBR Heat shock protein 60, mitochondrial
OS=Paracoccidioides brasiliensis GN=HSP60 PE=3 SV=1
Length = 592

Score = 30.4 bits (67), Expect = 5.8
Identities = 17/60 (28%), Positives = 33/60 (55%)
Frame = -3

Query: 184 TKRPLSRFQELGKTLQEIRICRQEY*RFALQERIERSKELATISR*IKSKGPVSSKSILI 5
T+ PLSRF+ G LQ+ R +E +F ++ R K + T+++ + + +++LI
Sbjct: 19 TRAPLSRFRSAGVGLQQQRFAHKEL-KFGVEARASLLKGIDTLAKAVTTTLGPKGRNVLI 77


tr_hit_id A7TMX1
Definition tr|A7TMX1|A7TMX1_VANPO Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294)
Align length 64
Score (bit) 34.7
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915595|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_D12.
(546 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7TMX1|A7TMX1_VANPO Putative uncharacterized protein OS=Vande... 35 3.4

>tr|A7TMX1|A7TMX1_VANPO Putative uncharacterized protein
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=Kpol_1051p7 PE=4 SV=1
Length = 375

Score = 34.7 bits (78), Expect = 3.4
Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
Frame = +3

Query: 324 LSLLIIYKKQKKSGLLPARS*PAC---MGLNLTRYGLHGPEPNKVWLAYLTQFKSSFYAI 494
L++ I+Y K+ + G++P + P C + NL G PE +++ L SF I
Sbjct: 306 LNIPIVYSKRSRDGMVPIANLPGCQEEVNYNLIASGYLNPEKSRILLQLCLAGSYSFNEI 365

Query: 495 AYVF 506
+VF
Sbjct: 366 RHVF 369