BP915604
Clone id YMU001_000073_E09
Library
Length 487
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGCACTATTGCTACCCTTGTGACAAAAGAAGAGAGGGAGATACTTACCGACAAGGAAGC
CATTGAAGAAGAGATACCAAGTAGATTGCAAGAAGCATTGAGAAGAAGCTCGATGCGCAG
AAGAACGGATGGGTGGAAGCTTTTACGAAGAACCTCAAGCAAGAGGCAAGAGAATGAGGC
TGAGAAGTGGATTGAAGTGGCCAAGAAAGAGAAGACGAAGGAGCATACAGGCACCCCAAC
TATATGTGCAACTCAACTATCAGTAACATGACATTGGAAGTAGAACAAAGGAGGAGGATA
TGGTCCATGCATGTAAGCATATCTGGTAATAAACACCATGATAATGTGGATTGTGTAAAG
CTTTTGATATTGTTTCGAGGGGCAGATTGACGCGTGGACTACAGGAGCTAGGAGTGTCAG
TAGAGCTCATATGGGAGATCTTCCACATGCACACCCACAAGATGGAAGTATGGAGGAAGG
AGATGGA
■■Homology search results ■■ -
sp_hit_id Q5R7F9
Definition sp|Q5R7F9|MA7D2_PONAB MAP7 domain-containing protein 2 OS=Pongo abelii
Align length 75
Score (bit) 35.4
E-value 0.14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915604|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_E09.
(487 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5R7F9|MA7D2_PONAB MAP7 domain-containing protein 2 OS=Pongo ... 35 0.14
sp|Q96T17|MA7D2_HUMAN MAP7 domain-containing protein 2 OS=Homo s... 35 0.14
sp|Q6Y7W8|PERQ2_MOUSE PERQ amino acid-rich with GYF domain-conta... 34 0.40
sp|Q6Y7W6|PERQ2_HUMAN PERQ amino acid-rich with GYF domain-conta... 34 0.40
sp|A2AG50|MA7D2_MOUSE MAP7 domain-containing protein 2 OS=Mus mu... 33 0.69
sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium discoi... 32 2.0
sp|P27123|NASP_RABIT Nuclear autoantigenic sperm protein (Fragme... 32 2.0
sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS... 32 2.0
sp|Q95KD7|K1407_MACFA Coiled-coil domain-containing protein KIAA... 32 2.0
sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33 OS=Arab... 31 2.6
sp|P53935|NST1_YEAST Stress response protein NST1 OS=Saccharomyc... 31 2.6
sp|A6ZRZ0|NST1_YEAS7 Stress response protein NST1 OS=Saccharomyc... 31 2.6
sp|Q6FM98|NST1_CANGA Stress response protein NST1 OS=Candida gla... 31 2.6
sp|Q9H3Y0|CRSPL_HUMAN Peptidase inhibitor R3HDML OS=Homo sapiens... 31 3.4
sp|O94538|SNU66_SCHPO U4/U6.U5 tri-snRNP-associated protein snu6... 31 3.4
sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyce... 31 3.4
sp|Q6BUT3|NST1_DEBHA Stress response protein NST1 OS=Debaryomyce... 31 3.4
sp|P59064|RS7_TREPR 30S ribosomal protein S7 OS=Tremblaya prince... 30 4.4
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogast... 30 4.5
sp|A3LYI0|NST1_PICST Stress response protein NST1 OS=Pichia stip... 30 4.5
sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xe... 30 4.5
sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS... 30 4.5
sp|P50998|AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe ... 30 4.5
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30... 30 5.8
sp|Q8NCU4|K1407_HUMAN Coiled-coil domain-containing protein KIAA... 30 5.8
sp|Q6AW69|CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus GN... 30 5.8
sp|P76573|YFGI_ECOLI Uncharacterized protein yfgI OS=Escherichia... 30 7.6
sp|Q58453|Y1053_METJA Uncharacterized protein MJ1053 OS=Methanoc... 30 7.6
sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2 30 7.6
sp|P07751|SPTA2_CHICK Spectrin alpha chain, brain OS=Gallus gall... 30 7.6

>sp|Q5R7F9|MA7D2_PONAB MAP7 domain-containing protein 2 OS=Pongo
abelii GN=MAP7D2 PE=2 SV=1
Length = 763

Score = 35.4 bits (80), Expect = 0.14
Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
Frame = +2

Query: 2 GTIATLVTKEEREILTDKEAIEEE-IPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENE 178
G A ++ ++ R+ KE E+E + Q+ L R ++R+ + +L +++QE E
Sbjct: 424 GEAAKILAEKRRQARLQKEQEEQERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEE 483

Query: 179 AEKWIEVAKKEKTKE 223
++ E KK++ +E
Sbjct: 484 RKRQEEEKKKQEEEE 498


>sp|Q96T17|MA7D2_HUMAN MAP7 domain-containing protein 2 OS=Homo
sapiens GN=MAP7D2 PE=2 SV=1
Length = 732

Score = 35.4 bits (80), Expect = 0.14
Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
Frame = +2

Query: 2 GTIATLVTKEEREILTDKEAIEEE-IPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENE 178
G A ++ ++ R+ KE E+E + Q+ L R ++R+ + +L +++QE E
Sbjct: 398 GEAAKILAEKRRQARLQKEQEEQERVEKEEQDRLEREELKRKAEEERLRLEEEARKQEEE 457

Query: 179 AEKWIEVAKKEKTKE 223
++ E KK++ +E
Sbjct: 458 RKRQEEEKKKQEGEE 472


>sp|Q6Y7W8|PERQ2_MOUSE PERQ amino acid-rich with GYF
domain-containing protein 2 OS=Mus musculus GN=Gigyf2
PE=1 SV=2
Length = 1291

Score = 33.9 bits (76), Expect = 0.40
Identities = 20/55 (36%), Positives = 31/55 (56%)
Frame = +2

Query: 26 KEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKW 190
+ E+EI ++ EEE + +EALRR RRR + + + ++QE EA KW
Sbjct: 798 QREQEIALRRQREEEERQQQ-EEALRRLEERRREEEERRKQEELLRKQEEEAAKW 851


>sp|Q6Y7W6|PERQ2_HUMAN PERQ amino acid-rich with GYF
domain-containing protein 2 OS=Homo sapiens GN=GIGYF2
PE=1 SV=1
Length = 1299

Score = 33.9 bits (76), Expect = 0.40
Identities = 20/55 (36%), Positives = 31/55 (56%)
Frame = +2

Query: 26 KEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKW 190
+ E+EI ++ EEE + +EALRR RRR + + + ++QE EA KW
Sbjct: 797 QREQEIALRRQREEEERQQQ-EEALRRLEERRREEEERRKQEELLRKQEEEAAKW 850


>sp|A2AG50|MA7D2_MOUSE MAP7 domain-containing protein 2 OS=Mus
musculus GN=Map7d2 PE=1 SV=1
Length = 781

Score = 33.1 bits (74), Expect = 0.69
Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 7/81 (8%)
Frame = +2

Query: 2 GTIATLVTKEEREILTDKEAIEEE-IPSRLQEALRRSSMRRRTDGWKLL------RRTSS 160
G A ++ ++ R+ KE E+E + +E L + ++R+ + +L R
Sbjct: 447 GEAAKILAEKRRQARLQKEQEEQERLEKEERERLEKEELKRKAEEERLRIEMAYKREQEK 506

Query: 161 KRQENEAEKWIEVAKKEKTKE 223
KRQE E ++ E KEK +E
Sbjct: 507 KRQEEEEKRKAEEKAKEKAEE 527


>sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium
discoideum GN=nol5 PE=3 SV=1
Length = 638

Score = 31.6 bits (70), Expect = 2.0
Identities = 16/66 (24%), Positives = 35/66 (53%)
Frame = +2

Query: 26 KEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIEVAK 205
KEE++ DK+ +EE + +E + + +T+ + + +++E + EK + K
Sbjct: 516 KEEKKEKKDKKEKKEEKEDKKEEKKEKKDKKEKTEETPVAKEEKKEKKEKKEEKEEKKDK 575

Query: 206 KEKTKE 223
KEK ++
Sbjct: 576 KEKKEK 581


>sp|P27123|NASP_RABIT Nuclear autoantigenic sperm protein (Fragment)
OS=Oryctolagus cuniculus GN=NASP PE=2 SV=2
Length = 693

Score = 31.6 bits (70), Expect = 2.0
Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
Frame = +2

Query: 29 EEREILTDKEAIEEEIPSRLQE----ALRRSSMRRRTDGWKLLRRTSSKRQENEAEK 187
EE ++ + + ++EE L+E A+ ++T+G L + ++K QE+E EK
Sbjct: 37 EEESLVENNDNVDEEAREELREQVYDAMGEKEESKKTEGMSLSKPETAKEQESEMEK 93


>sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A
OS=Xenopus laevis GN=mcm5-A PE=1 SV=2
Length = 735

Score = 31.6 bits (70), Expect = 2.0
Identities = 17/60 (28%), Positives = 30/60 (50%)
Frame = +2

Query: 32 EREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIEVAKKE 211
E+++ D +A + ++ R +E LR+ + G+ R KR N E WIEV ++
Sbjct: 18 EQQVGDDGQAKKSQLKKRFREFLRQYRIGTDRTGFTFKYRDELKRHYNLGEYWIEVEMED 77


>sp|Q95KD7|K1407_MACFA Coiled-coil domain-containing protein
KIAA1407 homolog OS=Macaca fascicularis GN=QflA-14927
PE=2 SV=1
Length = 935

Score = 31.6 bits (70), Expect = 2.0
Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = +2

Query: 17 LVTKEEREILTDKEAIEEEIPSRLQEALRRSSMRRRT--DGWKLLRRTSSKRQENEAEK 187
LV +E++ + + EEEI + + R RRRT + WK+ ++ + +N +EK
Sbjct: 230 LVQEEKKRKALEAKKEEEEIQREMVKLRREIIERRRTVKEAWKIEKKRQEENSQNSSEK 288


>sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33
OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2
Length = 834

Score = 31.2 bits (69), Expect = 2.6
Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 15/90 (16%)
Frame = +2

Query: 20 VTKEEREILT---DKEAIEEEIPSRLQEALRRSSMRRRTDGW------------KLLRRT 154
V KE+ +T ++E I EE+ S + + S ++DG KLL++
Sbjct: 371 VAKEKERFITIKNEQEVIMEELQSAMAQKAMLESQIAKSDGTMEKLNQKLDIAVKLLQKL 430

Query: 155 SSKRQENEAEKWIEVAKKEKTKEHTGTPTI 244
+R+E + E+ + + E+ + H T T+
Sbjct: 431 RDEREELQTERDRALREAEELRSHAETSTL 460


tr_hit_id Q58EJ7
Definition tr|Q58EJ7|Q58EJ7_DANRE LOC553341 protein (Fragment) OS=Danio rerio
Align length 68
Score (bit) 38.9
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915604|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_E09.
(487 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q58EJ7|Q58EJ7_DANRE LOC553341 protein (Fragment) OS=Danio rer... 39 0.13
tr|B6QR37|B6QR37_PENMA RNA export mediator Gle1, putative OS=Pen... 37 0.38
tr|A8QB41|A8QB41_BRUMA G-patch domain containing protein OS=Brug... 37 0.50
tr|Q39SE5|Q39SE5_GEOMG Putative uncharacterized protein OS=Geoba... 36 0.85
tr|A8P439|A8P439_BRUMA Putative uncharacterized protein OS=Brugi... 36 0.85
tr|A7RX50|A7RX50_NEMVE Predicted protein OS=Nematostella vectens... 35 1.4
tr|Q17FE4|Q17FE4_AEDAE Putative uncharacterized protein OS=Aedes... 35 1.9
tr|B6KSG4|B6KSG4_TOXGO Putative uncharacterized protein OS=Toxop... 35 1.9
tr|B7ZA02|B7ZA02_HUMAN cDNA, FLJ79016, weakly similar to Mus mus... 35 1.9
tr|B7Z895|B7Z895_HUMAN cDNA FLJ57681, weakly similar to Mus musc... 35 1.9
tr|B7Z3S7|B7Z3S7_HUMAN cDNA FLJ57335, weakly similar to Homo sap... 35 1.9
tr|B7Z2J8|B7Z2J8_HUMAN cDNA FLJ58136, weakly similar to Homo sap... 35 1.9
tr|B3KXC0|B3KXC0_HUMAN cDNA FLJ45113 fis, clone BRAWH3034743, we... 35 1.9
tr|Q1Q5J4|Q1Q5J4_9BACT Putative uncharacterized protein OS=Candi... 34 3.1
tr|B4LVY5|B4LVY5_DROVI GJ23622 OS=Drosophila virilis GN=GJ23622 ... 34 3.2
tr|A8P1Q2|A8P1Q2_BRUMA UBX domain containing protein OS=Brugia m... 34 3.2
tr|B6JVK9|B6JVK9_SCHJP Putative uncharacterized protein OS=Schiz... 34 3.2
tr|A4CTM0|A4CTM0_SYNPV Putative uncharacterized protein OS=Synec... 34 4.1
tr|A8USA7|A8USA7_9AQUI DNA mismatch repair protein MutS OS=Hydro... 34 4.2
tr|B3N1T4|B3N1T4_DROAN GF20765 OS=Drosophila ananassae GN=GF2076... 34 4.2
tr|A7RFK5|A7RFK5_NEMVE Predicted protein OS=Nematostella vectens... 34 4.2
tr|A5KB29|A5KB29_PLAVI Putative uncharacterized protein OS=Plasm... 34 4.2
tr|B4DZM1|B4DZM1_HUMAN cDNA FLJ58310, highly similar to Homo sap... 34 4.2
tr|A6H8W4|A6H8W4_HUMAN GIGYF2 protein OS=Homo sapiens GN=GIGYF2 ... 34 4.2
tr|Q2U5Y0|Q2U5Y0_ASPOR Predicted protein OS=Aspergillus oryzae G... 34 4.2
tr|B8NLY0|B8NLY0_ASPFL Putative uncharacterized protein OS=Asper... 34 4.2
tr|B8LVP6|B8LVP6_9EURO RNA export mediator Gle1, putative OS=Tal... 34 4.2
tr|A7MB14|A7MB14_BOVIN GIGYF2 protein OS=Bos taurus GN=GIGYF2 PE... 33 5.5
tr|B6M971|B6M971_BRAFL Putative uncharacterized protein OS=Branc... 33 5.5
tr|B6KDV9|B6KDV9_TOXGO Putative uncharacterized protein OS=Toxop... 33 5.5

>tr|Q58EJ7|Q58EJ7_DANRE LOC553341 protein (Fragment) OS=Danio rerio
GN=LOC553341 PE=2 SV=1
Length = 434

Score = 38.9 bits (89), Expect = 0.13
Identities = 20/68 (29%), Positives = 38/68 (55%)
Frame = +2

Query: 20 VTKEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIEV 199
+ +++++ + + +EEE R +E LR RR+ + + L K++E E +K IE
Sbjct: 367 IEEDKKKRQEEMQRLEEERRKREEEMLRLQEERRKQEEQQRLEEEKRKKEEEERKKQIEE 426

Query: 200 AKKEKTKE 223
KK+K K+
Sbjct: 427 KKKKKKKK 434


>tr|B6QR37|B6QR37_PENMA RNA export mediator Gle1, putative
OS=Penicillium marneffei ATCC 18224 GN=PMAA_042820 PE=4
SV=1
Length = 523

Score = 37.4 bits (85), Expect = 0.38
Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
Frame = +2

Query: 26 KEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAE-KWIEVA 202
+EER +KE +E E R +EA R+ R + ++ R +R++ EAE K I+ A
Sbjct: 101 EEERRRQAEKERLERERKER-EEAARKREEEARREAERIAREEEERRKKAEAEAKAIKAA 159

Query: 203 KKEKTK 220
++EKT+
Sbjct: 160 EEEKTR 165


>tr|A8QB41|A8QB41_BRUMA G-patch domain containing protein OS=Brugia
malayi GN=Bm1_47865 PE=4 SV=1
Length = 892

Score = 37.0 bits (84), Expect = 0.50
Identities = 22/75 (29%), Positives = 36/75 (48%)
Frame = +2

Query: 5 TIATLVTKEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAE 184
T+ LV ++ ++ E EI + E R+ R + G + +R SS ++E E
Sbjct: 358 TVDELVAEKHSKLERRMSGNENEIKRKTDERKRKKESRDKKHGKRYSKRNSSLSSDSEKE 417

Query: 185 KWIEVAKKEKTKEHT 229
W + KK K KEH+
Sbjct: 418 -WKLLEKKNKVKEHS 431


>tr|Q39SE5|Q39SE5_GEOMG Putative uncharacterized protein
OS=Geobacter metallireducens (strain GS-15 / ATCC 53774
/ DSM 7210) GN=Gmet_2610 PE=4 SV=1
Length = 162

Score = 36.2 bits (82), Expect = 0.85
Identities = 18/67 (26%), Positives = 34/67 (50%)
Frame = +2

Query: 20 VTKEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIEV 199
+T +ER++L E E +P QE LRR + R W+ + ++ + KW E+
Sbjct: 30 LTPDERQVLKPFEGRWESLPPERQERLRRGAER-----WRTMTPEEREQARERSRKWREL 84

Query: 200 AKKEKTK 220
++E+ +
Sbjct: 85 PREERER 91


>tr|A8P439|A8P439_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_15875 PE=4 SV=1
Length = 416

Score = 36.2 bits (82), Expect = 0.85
Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 13/66 (19%)
Frame = -1

Query: 421 TDTPSSCSPRVNLPLETIS-------------KALHNPHYHGVYYQICLHAWTISSSFVL 281
T P P + +PL T+S H YHG Y CL +W + ++L
Sbjct: 298 TMVPLIIVPLILVPLITVSYYGTSYHGTPYHXTXYHCTSYHGTSYHGCLLSWYLLPPYLL 357

Query: 280 LPMSCY 263
LP SCY
Sbjct: 358 LPTSCY 363


>tr|A7RX50|A7RX50_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g241286 PE=4 SV=1
Length = 1328

Score = 35.4 bits (80), Expect = 1.4
Identities = 21/66 (31%), Positives = 37/66 (56%)
Frame = +2

Query: 26 KEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIEVAK 205
+E E++ K EEE+ R Q+AL+ + R+R + R S +RQ++E+ ++ A
Sbjct: 925 READELMQQKRIREEELQRRRQQALQDAEKRKREEE----ERISLQRQQSESRRFAFQAH 980

Query: 206 KEKTKE 223
K K +E
Sbjct: 981 KVKLEE 986


>tr|Q17FE4|Q17FE4_AEDAE Putative uncharacterized protein OS=Aedes
aegypti GN=AAEL003441 PE=4 SV=1
Length = 1236

Score = 35.0 bits (79), Expect = 1.9
Identities = 22/70 (31%), Positives = 41/70 (58%)
Frame = -2

Query: 303 PYPPPLFYFQCHVTDS*VAHIVGVPVCSFVFSFLATSIHFSASFSCLLLEVLRKSFHPSV 124
P PP + + TD+ + +G+ +FVFS+L+T + + + L +E+LR +FH V
Sbjct: 8 PLTPPQEFPEPTPTDAYIIPTLGLHEGTFVFSYLSTFLSYITPYE-LPVELLRDTFHARV 66

Query: 123 LLRIELLLNA 94
+ ++L+L A
Sbjct: 67 SI-LQLILEA 75


>tr|B6KSG4|B6KSG4_TOXGO Putative uncharacterized protein
OS=Toxoplasma gondii ME49 GN=TGME49_014560 PE=4 SV=1
Length = 1341

Score = 35.0 bits (79), Expect = 1.9
Identities = 27/74 (36%), Positives = 36/74 (48%)
Frame = +2

Query: 17 LVTKEEREILTDKEAIEEEIPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENEAEKWIE 196
L TKE+ E L KE EEE R QE RR + R + + R+ ++E E EK
Sbjct: 390 LATKEKAEALKRKEQQEEE-KRREQELRRRRAEEARAEREREKRQREDAKKEKEKEK--- 445

Query: 197 VAKKEKTKEHTGTP 238
KK+ +E TP
Sbjct: 446 EKKKQIVEEQKQTP 459


>tr|B7ZA02|B7ZA02_HUMAN cDNA, FLJ79016, weakly similar to Mus
musculus microtubule-associated protein 7 (Mtap7), mRNA
OS=Homo sapiens PE=2 SV=1
Length = 687

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
Frame = +2

Query: 2 GTIATLVTKEEREILTDKEAIEEE-IPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENE 178
G A ++ ++ R+ KE E+E + Q+ L R ++R+ + +L +++QE E
Sbjct: 353 GEAAKILAEKRRQARLQKEQEEQERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEE 412

Query: 179 AEKWIEVAKKEKTKE 223
++ E KK++ +E
Sbjct: 413 RKRQEEEKKKQEGEE 427


>tr|B7Z895|B7Z895_HUMAN cDNA FLJ57681, weakly similar to Mus
musculus microtubule-associated protein 7 (Mtap7), mRNA
OS=Homo sapiens PE=2 SV=1
Length = 415

Score = 35.0 bits (79), Expect = 1.9
Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
Frame = +2

Query: 2 GTIATLVTKEEREILTDKEAIEEE-IPSRLQEALRRSSMRRRTDGWKLLRRTSSKRQENE 178
G A ++ ++ R+ KE E+E + Q+ L R ++R+ + +L +++QE E
Sbjct: 81 GEAAKILAEKRRQARLQKEQEEQERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEE 140

Query: 179 AEKWIEVAKKEKTKE 223
++ E KK++ +E
Sbjct: 141 RKRQEEEKKKQEGEE 155