BP915605
Clone id YMU001_000073_E10
Library
Length 514
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCCTCGAGTTAGTGGTGGTGGTGGTGGTGGCTCATGTGCTGGACGAGGGGTCGTAACAGT
AGCAGCTGCAATGGCTATTGGATTCTGGTTTAACCATGGCATCAGAGAGTTGCCTAATTG
TGCATGTGTTGCTGCAAGGCTTGCTAAGTCAGGGGCATCCTCCTGCTTTTGTGATTGACA
TGTACTTTTCAAAACTGTATTCAGTAATAATGCAGCATTTGGGAAAGCTGCCAAAGAATG
CATGGGGTGAAAGTAAGGCAGAGCCATATGAGGCCCATACATTCCAAATGGTAAAATATT
GTTGTGGCATGGCATTGAAGAATTTGGTTGATTTGCTGCTACCTTTTGCGCTGAGTTAAG
CTCTGATTCGGCACAAGTTGTCCTGGACAGCTTTGTTGTTTCTTGCGACTCATTCCGAAA
GGAATCGCTCTCAACTTCTTCAGTGCCTTGTTTATGAGGCTGTTGACAAAATCCTGGCGA
CAGTATCTTCTCTGAAACAGTGCATAACGGATGC
■■Homology search results ■■ -
sp_hit_id Q01217
Definition sp|Q01217|ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharomyces cerevisiae
Align length 57
Score (bit) 31.6
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915605|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_E10.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q01217|ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharom... 32 2.3
sp|P17177|CP27A_RABIT Cytochrome P450 27, mitochondrial OS=Oryct... 31 3.0
sp|Q54KG3|FFR_DICDI Protein fat-free homolog OS=Dictyostelium di... 30 5.0
sp|Q8NB78|AOF1_HUMAN Flavin-containing amine oxidase domain-cont... 30 5.1
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 O... 30 6.5
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4... 30 8.5
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4... 30 8.5
sp|Q91PP5|POLG_RTSVT Genome polyprotein OS=Rice tungro spherical... 30 8.7
sp|Q83034|POLG_RTSVA Genome polyprotein OS=Rice tungro spherical... 30 8.7
sp|Q6DE84|MAFB_XENLA Transcription factor MafB OS=Xenopus laevis... 30 8.7

>sp|Q01217|ARG56_YEAST Protein ARG5,6, mitochondrial
OS=Saccharomyces cerevisiae GN=ARG5,6 PE=1 SV=1
Length = 863

Score = 31.6 bits (70), Expect = 2.3
Identities = 16/57 (28%), Positives = 29/57 (50%)
Frame = +2

Query: 272 GPYIPNGKILLWHGIEEFG*FAATFCAELSSDSAQVVLDSFVVSCDSFRKESLSTSS 442
G Y+ GK+L W+GI++ ++ ++++FV SCD+ + S SS
Sbjct: 470 GSYLKGGKVLFWYGIDDI-------------NTISELVENFVKSCDTASTLNSSASS 513


>sp|P17177|CP27A_RABIT Cytochrome P450 27, mitochondrial
OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1
Length = 535

Score = 31.2 bits (69), Expect = 3.0
Identities = 16/33 (48%), Positives = 19/33 (57%)
Frame = +2

Query: 350 AELSSDSAQVVLDSFVVSCDSFRKESLSTSSVP 448
A L +D+ V+DSFVV D R ES S VP
Sbjct: 174 AALYTDALNEVIDSFVVRLDQLRAESASGDQVP 206


>sp|Q54KG3|FFR_DICDI Protein fat-free homolog OS=Dictyostelium
discoideum GN=ffr PE=3 SV=1
Length = 917

Score = 30.4 bits (67), Expect = 5.0
Identities = 19/59 (32%), Positives = 28/59 (47%)
Frame = +3

Query: 174 IDMYFSKLYSVIMQHLGKLPKNAWGESKAEPYEAHTFQMVKYCCGMALKNLVDLLLPFA 350
ID YF L I +H+ +L + E + E E H Q + A+ N D++L FA
Sbjct: 520 IDFYFDNLQKTIKEHIHQL-NSTLNERRDEVLEGHNLQELSDATSKAIVN--DIILLFA 575


>sp|Q8NB78|AOF1_HUMAN Flavin-containing amine oxidase
domain-containing protein 1 OS=Homo sapiens GN=AOF1 PE=1
SV=2
Length = 823

Score = 30.4 bits (67), Expect = 5.1
Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 3/80 (3%)
Frame = -1

Query: 295 FTIWN-VWASYGSALLSPHAFFGS--FPKCCIITEYSFEKYMSITKAGGCP*LSKPCSNT 125
+T W +W S G SP AF P T+ K+ +TK L+ + T
Sbjct: 110 YTTWKKIWTSNGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQ---LTPQIAKT 166

Query: 124 CTIRQLSDAMVKPESNSHCS 65
+ +KPE++ HCS
Sbjct: 167 YRCGMKPNTAIKPETSDHCS 186


>sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4
OS=Rattus norvegicus GN=Herc4 PE=2 SV=1
Length = 1057

Score = 30.0 bits (66), Expect = 6.5
Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
Frame = +3

Query: 270 EAHTFQMVKYCCGMALKN--LVDLLLPFALS*ALIRHKLSWTALLFLATHSERNRSQLL 440
++ F ++ CG+A+ N +VDL P AL L++ K S L L R+ QLL
Sbjct: 791 DSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPDVGRSMQQLL 849


>sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4
OS=Mus musculus GN=Herc4 PE=2 SV=2
Length = 1057

Score = 29.6 bits (65), Expect = 8.5
Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
Frame = +3

Query: 270 EAHTFQMVKYCCGMALKN--LVDLLLPFALS*ALIRHKLSWTALLFLATHSERNRSQLL 440
++ F ++ CG+A+ N +VDL P AL L++ K S L L R+ QLL
Sbjct: 791 DSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPAVGRSMQQLL 849


>sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4
OS=Homo sapiens GN=HERC4 PE=1 SV=1
Length = 1057

Score = 29.6 bits (65), Expect = 8.5
Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
Frame = +3

Query: 270 EAHTFQMVKYCCGMALKN--LVDLLLPFALS*ALIRHKLSWTALLFLATHSERNRSQLL 440
++ F ++ CG+A+ N +VDL P AL L++ K S L L R+ QLL
Sbjct: 791 DSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLL 849


>sp|Q91PP5|POLG_RTSVT Genome polyprotein OS=Rice tungro spherical
virus (strain Vt6) PE=1 SV=1
Length = 3471

Score = 29.6 bits (65), Expect = 8.7
Identities = 16/52 (30%), Positives = 23/52 (44%)
Frame = -1

Query: 328 TKFFNAMPQQYFTIWNVWASYGSALLSPHAFFGSFPKCCIITEYSFEKYMSI 173
T FN+ YF ++ GS+LLSP F C I Y + +S+
Sbjct: 3224 TVIFNSFVNYYFMALAWMSTVGSSLLSPQGSCKDFDTYCKIVAYGDDNVVSV 3275


>sp|Q83034|POLG_RTSVA Genome polyprotein OS=Rice tungro spherical
virus (strain A) PE=1 SV=1
Length = 3473

Score = 29.6 bits (65), Expect = 8.7
Identities = 16/52 (30%), Positives = 23/52 (44%)
Frame = -1

Query: 328 TKFFNAMPQQYFTIWNVWASYGSALLSPHAFFGSFPKCCIITEYSFEKYMSI 173
T FN+ YF ++ GS+LLSP F C I Y + +S+
Sbjct: 3227 TVIFNSFVNYYFMALAWMSTVGSSLLSPQGSCKDFDTYCKIVAYGDDNVVSV 3278


>sp|Q6DE84|MAFB_XENLA Transcription factor MafB OS=Xenopus laevis
GN=mafb PE=2 SV=1
Length = 313

Score = 29.6 bits (65), Expect = 8.7
Identities = 23/90 (25%), Positives = 35/90 (38%), Gaps = 9/90 (10%)
Frame = -2

Query: 480 SPGFCQQPHKQGTEEV---ESDSFRNESQETTKLSRTTCAESELNSAQKVAANQPNSSMP 310
SP F HK +++ S S+++ S E L+ E+ + Q Q S
Sbjct: 71 SPSFSPTEHKTHLDDLYWMSSSSYQHVSPEALNLTPEDAVEALIGQHQMPPQLQGYESFR 130

Query: 309 CH------NNILPFGMYGPHMALPYFHPMH 238
H N G++ M LP+ HP H
Sbjct: 131 AHHHHHHQNQHQYQGVHHEEMGLPHHHPHH 160


tr_hit_id A8P884
Definition tr|A8P884|A8P884_BRUMA Putative uncharacterized protein OS=Brugia malayi
Align length 78
Score (bit) 36.2
E-value 0.96
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915605|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_E10.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8P884|A8P884_BRUMA Putative uncharacterized protein OS=Brugi... 36 0.96
tr|A9TWQ4|A9TWQ4_PHYPA Predicted protein OS=Physcomitrella paten... 33 6.4
tr|Q3LA05|Q3LA05_RHOE4 Putative uncharacterized protein OS=Rhodo... 33 8.3

>tr|A8P884|A8P884_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_18835 PE=4 SV=1
Length = 991

Score = 36.2 bits (82), Expect = 0.96
Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 8/78 (10%)
Frame = +3

Query: 303 CGMALKNLVDLLLPFALS*ALIRHKLSWTALLFLATHSERNRSQLLQCLV--------YE 458
C M+L NL + + + A++ K W L L +H E S L CL+ +
Sbjct: 798 CLMSLSNLNSVQVDTLVHLAVVLQKRDWAMQLLLGSHDEYRTSALRACLLASDVSSEGAQ 857

Query: 459 AVDKILATVSSLKQCITD 512
++ K++AT +C+TD
Sbjct: 858 SIIKLVATNLIANECMTD 875


>tr|A9TWQ4|A9TWQ4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_172407 PE=4 SV=1
Length = 1155

Score = 33.5 bits (75), Expect = 6.4
Identities = 28/91 (30%), Positives = 35/91 (38%), Gaps = 6/91 (6%)
Frame = -2

Query: 438 EVESDSFRNESQETTKLSRTT-CAESELNSAQKVAANQP-----NSSMPCHNNILPFGMY 277
E D+ R + +ET KL AE EL SA+ NQ SS P H F
Sbjct: 342 EAAEDTIRTQVEETEKLRNALRVAEMELQSAKIEEQNQGLNEGYRSSQPFHGRNRSFQGQ 401

Query: 276 GPHMALPYFHPMHSXXXXXXXXXXXNTVLKS 184
+ L + HPMH T+ KS
Sbjct: 402 PGSVRLAFQHPMHQNGDNYGELRNGQTLKKS 432


>tr|Q3LA05|Q3LA05_RHOE4 Putative uncharacterized protein
OS=Rhodococcus erythropolis (strain PR4) GN=pREL1_0015
PE=4 SV=1
Length = 666

Score = 33.1 bits (74), Expect = 8.3
Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 6/40 (15%)
Frame = -2

Query: 183 TCQSQKQEDAPDLASLAATHAQLGNSLMP------WLNQN 82
T Q Q Q +PDLAS++A + + N+L+P W+ QN
Sbjct: 283 TLQKQLQSGSPDLASVSAAASDIANTLVPVADTTKWVTQN 322