BP915608
Clone id YMU001_000073_F01
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTCGGTTGTAATCCTCAAGCCAGCTTTCCTCCTCACAGGCTGATATCCATTTTTCAAT
TTTATCCAGTATTTCTCTTCGGCTGTTGGCCTTCTCTTTGGCAATGCTTATCTTGTCATC
CATGGTTGCTAAAATACTGGAAGCATCAAATAGGCCGGACTCAATAATAGCCAAAATTTG
TTCATGAGAGGCATCCGGGTCCGGCTCCATGTGGGCCTCTGCATACACATCATCTAGCTC
AGCTTGCTTCTTCAGGACAAGCTCTTTCATCTTGCTTGCTTTAAGCGTGTCAGGTCTTTG
CACCTCCTCCTCTGCCTGGCATATTTTGTCAAGTGAAAGGATTCCAGGTCCAGAGACTTC
ATTCTCCTTGGCCCCAATAATATTTGTGATGTTTCGAAATGGGCGCCGCTCATCATGAGG
TGTGTCCATTAGGTCCCAAAGCTCAAACAAAGAAGTGCCCAAGTCTTGAATCTTATGTAA
GCGCTTCTTTCTTTCATGTTGTAAAGATTGGACAGTTAATTTCAGGCCATCAAGAGTTTC
ATCACTGATG
■■Homology search results ■■ -
sp_hit_id Q99K43
Definition sp|Q99K43|PRC1_MOUSE Protein regulator of cytokinesis 1 OS=Mus musculus
Align length 178
Score (bit) 43.1
E-value 0.0008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915608|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F01.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q99K43|PRC1_MOUSE Protein regulator of cytokinesis 1 OS=Mus m... 43 8e-04
sp|A6NDK9|GOG6C_HUMAN Golgin subfamily A member 6C OS=Homo sapie... 42 0.002
sp|Q9NYA3|GOG6A_HUMAN Golgin subfamily A member 6A OS=Homo sapie... 42 0.002
sp|O43663|PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo ... 40 0.005
sp|A6NDN3|GOG6B_HUMAN Golgin subfamily A member 6B OS=Homo sapie... 40 0.005
sp|A6NEF3|GG6L4_HUMAN Putative golgin subfamily A member 6-like ... 37 0.046
sp|A6NEY3|GG6L3_HUMAN Putative golgin subfamily A member 6-like ... 36 0.10
sp|Q8N824|GG6L8_HUMAN Putative golgin subfamily A member 6-like ... 36 0.13
sp|A6NI86|GG6LA_HUMAN Putative golgin subfamily A member 6-like ... 35 0.18
sp|A6NFL8|GG6L5_HUMAN Putative golgin subfamily A member 6-like ... 35 0.18
sp|Q27802|DYHC2_TRIGR Cytoplasmic dynein 2 heavy chain 1 OS=Trip... 35 0.18
sp|Q9M7J4|MFP1_TOBAC MAR-binding filament-like protein 1-1 OS=Ni... 35 0.30
sp|A3CPX8|CNPD_STRSV 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 33 0.87
sp|Q6GM06|OTU6B_XENLA OTU domain-containing protein 6B OS=Xenopu... 32 1.5
sp|Q9D0F1|NDC80_MOUSE Kinetochore protein NDC80 homolog OS=Mus m... 32 1.5
sp|Q5YS64|RRF_NOCFA Ribosome-recycling factor OS=Nocardia farcin... 32 1.9
sp|Q92541|RTF1_HUMAN RNA polymerase-associated protein RTF1 homo... 32 2.5
sp|Q2H0I3|KU70_CHAGB Protein Ku70 OS=Chaetomium globosum GN=KU70... 32 2.5
sp|Q3URD3|SLMAP_MOUSE Sarcolemmal membrane-associated protein OS... 31 3.3
sp|Q5RAD5|RTF1_PONAB RNA polymerase-associated protein RTF1 homo... 31 3.3
sp|Q9USP4|MUG1_SCHPO Meiotically up-regulated gene 1 protein OS=... 31 3.3
sp|Q6CST6|SNU71_KLULA U1 small nuclear ribonucleoprotein compone... 31 4.3
sp|Q96C34|RUND1_HUMAN RUN domain-containing protein 1 OS=Homo sa... 31 4.3
sp|A6NEM1|GG6L9_HUMAN Golgin subfamily A member 6-like protein 9... 31 4.3
sp|Q8IWJ2|GCC2_HUMAN GRIP and coiled-coil domain-containing prot... 31 4.3
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesie... 31 4.3
sp|Q8CPT5|CLPB_STAES Chaperone protein clpB OS=Staphylococcus ep... 31 4.3
sp|Q5HQI5|CLPB_STAEQ Chaperone protein clpB OS=Staphylococcus ep... 31 4.3
sp|A5DAQ7|YD156_PICGU WD repeat-containing protein PGUG_00362 OS... 30 5.7
sp|Q0T5J8|TREA_SHIF8 Periplasmic trehalase OS=Shigella flexneri ... 30 5.7

>sp|Q99K43|PRC1_MOUSE Protein regulator of cytokinesis 1 OS=Mus
musculus GN=Prc1 PE=2 SV=1
Length = 603

Score = 43.1 bits (100), Expect = 8e-04
Identities = 44/178 (24%), Positives = 79/178 (44%), Gaps = 2/178 (1%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
+S E + L+ ++ L+ ++ + + + L T + ELWD + P +ER P I + G+
Sbjct: 210 LSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAI--MTGS 267

Query: 354 KENEVSGPGILSLDKICQA-EEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPD 178
K KI A + EV R + LK +K+++ K + EL + +
Sbjct: 268 K------------TKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFY----- 310

Query: 177 ASHEQILAIIESGLFD-ASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESW 7
S EQ A D ++L D +I + ++ +E+ ++KW EESW
Sbjct: 311 -SQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDAHKELFQGVQKW-----EESW 362



Score = 30.8 bits (68), Expect = 4.3
Identities = 26/105 (24%), Positives = 45/105 (42%)
Frame = -2

Query: 327 ILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDASHEQILAII 148
IL L+K + + E+ R + + +L+ +++ EL D+ P D + +
Sbjct: 96 ILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPCDVDSTSVPTLE 151

Query: 147 ESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEE 13
E LF +++ +E SRRE I+K I C EE
Sbjct: 152 ELKLFR---------QRVATLRETKESRREEFVNIKKQIILCMEE 187


>sp|A6NDK9|GOG6C_HUMAN Golgin subfamily A member 6C OS=Homo sapiens
GN=GOLGA6C PE=3 SV=1
Length = 693

Score = 42.0 bits (97), Expect = 0.002
Identities = 36/170 (21%), Positives = 78/170 (45%), Gaps = 2/170 (1%)
Frame = -2

Query: 510 LKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGAKENEVS-- 337
+ + ++L+ E+K+ +H+IQ+L SL EL + M P P +T+++ ++E
Sbjct: 250 MSVEARTLKEEKKRDIHRIQELERSLSELKNQMAEPPSLAPP--AVTSVVEQLQDEAKHL 307

Query: 336 GPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDASHEQIL 157
+ L+ Q++ E + +L + + K+ + +++ L + A+ E + + L
Sbjct: 308 RQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEAQRVREQERLCEQNERL 367

Query: 156 AIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESW 7
+ L + L + ++ +E+ E L K EK + EE W
Sbjct: 368 REQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLW 417


>sp|Q9NYA3|GOG6A_HUMAN Golgin subfamily A member 6A OS=Homo sapiens
GN=GOLGA6 PE=1 SV=3
Length = 693

Score = 42.0 bits (97), Expect = 0.002
Identities = 36/170 (21%), Positives = 78/170 (45%), Gaps = 2/170 (1%)
Frame = -2

Query: 510 LKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGAKENEVS-- 337
+ + ++L+ E+K+ +H+IQ+L SL EL + M P P +T+++ ++E
Sbjct: 250 MSVEARTLKEEKKRDIHRIQELERSLSELKNQMAEPPSLAPP--AVTSVVEQLQDEAKHL 307

Query: 336 GPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDASHEQIL 157
+ L+ Q++ E + +L + + K+ + +++ L + A+ E + + L
Sbjct: 308 RQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEAQRVREQERLCEQNERL 367

Query: 156 AIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESW 7
+ L + L + ++ +E+ E L K EK + EE W
Sbjct: 368 REQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLW 417


>sp|O43663|PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo
sapiens GN=PRC1 PE=1 SV=2
Length = 620

Score = 40.4 bits (93), Expect = 0.005
Identities = 41/177 (23%), Positives = 72/177 (40%), Gaps = 1/177 (0%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
+S E + L+ ++ L+ ++ + + L T + ELWD + P +ER I + A
Sbjct: 210 LSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKA 269

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
K + + EV R + LK MK+++ + EL + +
Sbjct: 270 KVRKA-------------LQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFY------ 310

Query: 174 SHEQILAIIESGLFD-ASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESW 7
S EQ A D S+L D +I K +E+ + ++KW EE+W
Sbjct: 311 SQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKW-----EETW 362



Score = 29.6 bits (65), Expect = 9.7
Identities = 27/95 (28%), Positives = 43/95 (45%)
Frame = -2

Query: 435 LFELWDLMDTPHDERRPFRNITNIIGAKENEVSGPGILSLDKICQAEEEVQRPDTLKASK 256
L E+W+L+ P D+R + EV I L + AEEE +LK
Sbjct: 22 LREIWELIGIPEDQR-----------LQRTEVVKKHIKELLDMMIAEEE-----SLKERL 65

Query: 255 MKELVLKKQAELDDVYAEAHMEPDPDASHEQILAI 151
+K + + Q EL+ + +E H+EP + IL +
Sbjct: 66 IKSISV-CQKELNTLCSELHVEPFQEEGETTILQL 99


>sp|A6NDN3|GOG6B_HUMAN Golgin subfamily A member 6B OS=Homo sapiens
GN=GOLGA6B PE=3 SV=3
Length = 693

Score = 40.4 bits (93), Expect = 0.005
Identities = 35/170 (20%), Positives = 77/170 (45%), Gaps = 2/170 (1%)
Frame = -2

Query: 510 LKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGAKENEVS-- 337
+ + ++L+ E+K+ +H+IQ+L SL EL + M P P +T+++ ++E
Sbjct: 250 MSVEARTLKEEKKRDIHRIQELERSLSELKNQMAKPPSLAPP--AVTSVVEQLQDEAKHL 307

Query: 336 GPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDASHEQIL 157
+ L+ Q++ E + +L + + K+ + +++ L + + E + + L
Sbjct: 308 RQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEVQRVREQERLCEQNERL 367

Query: 156 AIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESW 7
+ L + L + ++ +E+ E L K EK + EE W
Sbjct: 368 REQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLW 417


>sp|A6NEF3|GG6L4_HUMAN Putative golgin subfamily A member 6-like
protein 4 OS=Homo sapiens PE=5 SV=2
Length = 488

Score = 37.4 bits (85), Expect = 0.046
Identities = 40/193 (20%), Positives = 82/193 (42%), Gaps = 16/193 (8%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTP---------------H 400
I + + + V++ + E+K +H +Q LG SLF+L + P
Sbjct: 104 IISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQ 163

Query: 399 DERRPFRNITNIIGAK-ENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAE 223
DE R +G + + EV +LSL + + +EE R + + +E + +++
Sbjct: 164 DETNHLRKELESVGRQLQAEVENNQMLSL--LNRRQEERLREQEERLREQEERLREQEDR 221

Query: 222 LDDVYAEAHMEPDPDASHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKI 43
L + + + E+ L E L + L ++++ +E+ + + E L +
Sbjct: 222 LHEQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLHEQEERLREQ 281

Query: 42 EKWISACEEESWL 4
E+ + CE+E L
Sbjct: 282 EERL--CEQEERL 292


>sp|A6NEY3|GG6L3_HUMAN Putative golgin subfamily A member 6-like
protein 3 OS=Homo sapiens PE=5 SV=3
Length = 463

Score = 36.2 bits (82), Expect = 0.10
Identities = 40/193 (20%), Positives = 81/193 (41%), Gaps = 16/193 (8%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTP---------------H 400
I + + + V++ + E+K +H +Q LG SLF+L + P
Sbjct: 104 IISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQ 163

Query: 399 DERRPFRNITNIIGAK-ENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAE 223
DE R +G + + EV +LSL + + +EE R + + +E + +++
Sbjct: 164 DETNHLRKELESVGRQLQAEVENNQMLSL--LNRRQEERLREQEERLREQEERLREQEER 221

Query: 222 LDDVYAEAHMEPDPDASHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKI 43
L + + + E+ L E L + L ++++ +E+ + E L +
Sbjct: 222 LCEQEERLREQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLHEQ 281

Query: 42 EKWISACEEESWL 4
E+ + CE+E L
Sbjct: 282 EERL--CEQEERL 292


>sp|Q8N824|GG6L8_HUMAN Putative golgin subfamily A member 6-like
protein 8 OS=Homo sapiens PE=5 SV=1
Length = 466

Score = 35.8 bits (81), Expect = 0.13
Identities = 41/198 (20%), Positives = 83/198 (41%), Gaps = 21/198 (10%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTP---------------H 400
I + + + V++ + E+K +H +Q LG SLF+L + P
Sbjct: 104 IISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQ 163

Query: 399 DERRPFRNITNIIGAK-ENEVSGPGILSL-----DKICQAEEEVQRPDTLKASKMKELVL 238
DE R +G + + EV +LSL ++ + +EE R + + +E +
Sbjct: 164 DETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEERLREQEERLREQEERLREQEERLH 223

Query: 237 KKQAELDDVYAEAHMEPDPDASHEQILAIIESGLFDASSILATMDDKISIAKEKANSRRE 58
+++ L + + + HE+ L E L + L ++++ +E+ + E
Sbjct: 224 EQEERLCEQEERLCEQEERLREHEERLCEQEERLREHEERLCEQEERLCEQEERLREQEE 283

Query: 57 ILDKIEKWISACEEESWL 4
L + E+ + CE+E L
Sbjct: 284 RLCEQEERL--CEQEERL 299


>sp|A6NI86|GG6LA_HUMAN Putative golgin subfamily A member 6-like
protein 10 OS=Homo sapiens PE=5 SV=2
Length = 393

Score = 35.4 bits (80), Expect = 0.18
Identities = 40/182 (21%), Positives = 80/182 (43%), Gaps = 8/182 (4%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRP--------FR 379
I + + + V++ + E+K +H +Q LG SLF+L + P P +
Sbjct: 104 IISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQ 163

Query: 378 NITNIIGAKENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEA 199
+ TN + KE E S+ + QAE E + +L + +E + +++ L +
Sbjct: 164 DETNHL-RKELE-------SVGRQLQAEVENNQMLSLLNRRQEERLREQEERLHEQEERL 215

Query: 198 HMEPDPDASHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACE 19
H + + E+ L E L + L ++++ +E+ + E L + E+ + CE
Sbjct: 216 HEQEERLCEQEERLCEQEERLREQEERLREQEERLHEQEERLCEQEERLCEQEERL--CE 273

Query: 18 EE 13
+E
Sbjct: 274 QE 275


>sp|A6NFL8|GG6L5_HUMAN Putative golgin subfamily A member 6-like
protein 5 OS=Homo sapiens PE=5 SV=3
Length = 401

Score = 35.4 bits (80), Expect = 0.18
Identities = 39/190 (20%), Positives = 80/190 (42%), Gaps = 16/190 (8%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTP---------------H 400
I + + + V++ + E+K +H +Q LG SLF+L + P
Sbjct: 104 IISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQ 163

Query: 399 DERRPFRNITNIIGAK-ENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAE 223
DE R +G + + EV +LSL + + +EE R + + +E + +++
Sbjct: 164 DETNHLRKELESVGRQLQAEVENNQMLSL--LNRRQEERLREQEERLREQEERLREQEDR 221

Query: 222 LDDVYAEAHMEPDPDASHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKI 43
L + + + E+ L E L + L ++++ +E+ + E L +
Sbjct: 222 LHEQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLCEQEERLREQ 281

Query: 42 EKWISACEEE 13
E+ + CE+E
Sbjct: 282 EERL--CEQE 289


tr_hit_id Q9FEV9
Definition tr|Q9FEV9|Q9FEV9_TOBAC Microtubule-associated protein MAP65-1a OS=Nicotiana tabacum
Align length 178
Score (bit) 203.0
E-value 5.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915608|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F01.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FEV9|Q9FEV9_TOBAC Microtubule-associated protein MAP65-1a O... 203 5e-51
tr|A7P0J4|A7P0J4_VITVI Chromosome chr19 scaffold_4, whole genome... 194 2e-48
tr|A5AW68|A5AW68_VITVI Putative uncharacterized protein OS=Vitis... 194 2e-48
tr|B6U4I4|B6U4I4_MAIZE Microtubule-associated protein MAP65-1a O... 192 1e-47
tr|Q9FLP0|Q9FLP0_ARATH Arabidopsis thaliana genomic DNA, chromos... 191 2e-47
tr|Q5Z4M2|Q5Z4M2_ORYSJ Putative microtubule-associated protein O... 191 2e-47
tr|Q5Z4M1|Q5Z4M1_ORYSJ Os06g0308300 protein OS=Oryza sativa subs... 191 2e-47
tr|B8B123|B8B123_ORYSI Putative uncharacterized protein OS=Oryza... 191 2e-47
tr|Q9FEV8|Q9FEV8_TOBAC Microtubule-associated protein MAP65-1b O... 190 4e-47
tr|A9T237|A9T237_PHYPA Predicted protein OS=Physcomitrella paten... 189 8e-47
tr|Q9FEV7|Q9FEV7_TOBAC Microtubule-associated protein MAP65-1c O... 187 3e-46
tr|Q84VU1|Q84VU1_DAUCA 65kD microtubule associated protein OS=Da... 186 5e-46
tr|A9RIF3|A9RIF3_PHYPA Predicted protein OS=Physcomitrella paten... 185 1e-45
tr|Q32WR4|Q32WR4_ZINEL Microtubule associated protein OS=Zinnia ... 184 3e-45
tr|A9T236|A9T236_PHYPA Predicted protein OS=Physcomitrella paten... 183 4e-45
tr|A9SXZ7|A9SXZ7_PHYPA Predicted protein OS=Physcomitrella paten... 183 6e-45
tr|Q9SZ16|Q9SZ16_ARATH Putative uncharacterized protein F10M23.1... 182 1e-44
tr|Q8LEG3|Q8LEG3_ARATH Microtubule-associated protein MAP65-1a (... 182 1e-44
tr|Q6ZI13|Q6ZI13_ORYSJ Os02g0720200 protein OS=Oryza sativa subs... 181 2e-44
tr|A3AAT0|A3AAT0_ORYSJ Putative uncharacterized protein OS=Oryza... 181 2e-44
tr|A2X909|A2X909_ORYSI Putative uncharacterized protein OS=Oryza... 181 2e-44
tr|Q69XG1|Q69XG1_ORYSJ Os06g0611000 protein OS=Oryza sativa subs... 180 5e-44
tr|A2YEY2|A2YEY2_ORYSI Putative uncharacterized protein OS=Oryza... 180 5e-44
tr|A7P409|A7P409_VITVI Chromosome chr1 scaffold_5, whole genome ... 178 1e-43
tr|Q9SIS3|Q9SIS3_ARATH Putative uncharacterized protein At2g0191... 177 3e-43
tr|Q6L4A9|Q6L4A9_SOLDE Putative microtubule-associated protein, ... 177 3e-43
tr|Q2V4B4|Q2V4B4_ARATH Uncharacterized protein At2g01910.2 OS=Ar... 177 3e-43
tr|Q0WPU6|Q0WPU6_ARATH Putative uncharacterized protein At2g0191... 177 3e-43
tr|A9SXZ8|A9SXZ8_PHYPA Predicted protein OS=Physcomitrella paten... 177 4e-43
tr|B6U1C0|B6U1C0_MAIZE Microtubule-associated protein MAP65-1a O... 176 5e-43

>tr|Q9FEV9|Q9FEV9_TOBAC Microtubule-associated protein MAP65-1a
OS=Nicotiana tabacum GN=map65-1a PE=2 SV=1
Length = 580

Score = 203 bits (516), Expect = 5e-51
Identities = 101/178 (56%), Positives = 139/178 (78%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV L+ ++K+RLHK+Q+L T L +LW+LMDTP +ER F ++T I A
Sbjct: 222 ISNDTLSSLAKTVLVLKEDKKQRLHKLQELATQLIDLWNLMDTPEEERSLFDHVTCNISA 281

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EV+ PG L+LD I QAE EV+R D LKASKMKE+ K+QAEL+D+YA AH+E D +A
Sbjct: 282 SVDEVAIPGALALDLIEQAEVEVERLDQLKASKMKEIAFKRQAELEDIYARAHVEIDTEA 341

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ E+I+A+I+SG D + +LA MD++I AKE+A+SR+EILDK+EKW++ACEEESWLE
Sbjct: 342 AREKIMALIDSGNVDPAELLADMDNQIVNAKEEAHSRKEILDKVEKWMAACEEESWLE 399


>tr|A7P0J4|A7P0J4_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027255001
PE=4 SV=1
Length = 428

Score = 194 bits (494), Expect = 2e-48
Identities = 96/178 (53%), Positives = 139/178 (78%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L+ ++K+RL K+Q+L T L +LW+LMDTP +ER F ++T I A
Sbjct: 200 ISNDTLSRLAKTVLALKEDKKQRLQKLQELATQLIDLWNLMDTPEEERSLFDHVTCNISA 259

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EV+ PG L+LD I QAE EV+R D LKAS+MKE+ K+QAEL++++A AH+E DP+A
Sbjct: 260 SVDEVTIPGALALDLIEQAEVEVERLDQLKASRMKEIAFKRQAELEEIFARAHIEIDPEA 319

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ +I+++I+SG + S +LA MD++I+ AKE+A SR++ILDK+EKW+SACEEESWLE
Sbjct: 320 ARAKIMSLIDSGDVEPSELLADMDNQITKAKEEAFSRKDILDKVEKWMSACEEESWLE 377


>tr|A5AW68|A5AW68_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007561 PE=4 SV=1
Length = 623

Score = 194 bits (494), Expect = 2e-48
Identities = 96/178 (53%), Positives = 139/178 (78%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L+ ++K+RL K+Q+L T L +LW+LMDTP +ER F ++T I A
Sbjct: 263 ISNDTLSRLAKTVLALKEDKKQRLQKLQELATQLIDLWNLMDTPEEERSLFDHVTCNISA 322

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EV+ PG L+LD I QAE EV+R D LKAS+MKE+ K+QAEL++++A AH+E DP+A
Sbjct: 323 SVDEVTIPGALALDLIEQAEVEVERLDQLKASRMKEIAFKRQAELEEIFARAHIEIDPEA 382

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ +I+++I+SG + S +LA MD++I+ AKE+A SR++ILDK+EKW+SACEEESWLE
Sbjct: 383 ARAKIMSLIDSGDVEPSELLADMDNQITKAKEEAFSRKDILDKVEKWMSACEEESWLE 440


>tr|B6U4I4|B6U4I4_MAIZE Microtubule-associated protein MAP65-1a
OS=Zea mays PE=2 SV=1
Length = 584

Score = 192 bits (487), Expect = 1e-47
Identities = 98/178 (55%), Positives = 132/178 (74%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L ++K RL K+Q+L L++LWDLMD P +ERR F ++T A
Sbjct: 216 ISNDTLSKLDNTVATLNEDKKLRLSKLQELAGQLYDLWDLMDAPKEERRMFDHVTCNRSA 275

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EV+ PG L+LD I QAE EVQR D LK SKMKE+ KKQ EL+D+YA AH+ D A
Sbjct: 276 SVDEVTAPGSLALDLIEQAEVEVQRLDQLKYSKMKEIAFKKQTELEDIYAGAHIVIDTAA 335

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+HE+ILA+IE+G + S ++A MD +I+ AKE+A SR++ILDK+E+W+SACEEESWLE
Sbjct: 336 AHEKILALIEAGNIEPSELIADMDTQIAKAKEEALSRKDILDKVERWMSACEEESWLE 393


>tr|Q9FLP0|Q9FLP0_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, P1 clone:MCO15 (Putative uncharacterized protein
At5g55230) (At5g55230) OS=Arabidopsis thaliana
GN=At5g55230 PE=2 SV=1
Length = 587

Score = 191 bits (486), Expect = 2e-47
Identities = 94/178 (52%), Positives = 137/178 (76%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS+ETL L TV +L+ ++K+RL K+Q+L T L +LW+LMDTP +ER F ++T I +
Sbjct: 221 ISNETLSRLAKTVLTLKDDKKQRLQKLQELATQLIDLWNLMDTPDEERELFDHVTCNISS 280

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EV+ PG L+ D I QAE EV R D LKAS+MKE+ KKQ+EL+++YA AH+E +P++
Sbjct: 281 SVDEVTVPGALARDLIEQAEVEVDRLDQLKASRMKEIAFKKQSELEEIYARAHVEVNPES 340

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ E+I+++I+SG + + +LA MD +IS AKE+A SR++ILD++EKW+SACEEESWLE
Sbjct: 341 ARERIMSLIDSGNVEPTELLADMDSQISKAKEEAFSRKDILDRVEKWMSACEEESWLE 398


>tr|Q5Z4M2|Q5Z4M2_ORYSJ Putative microtubule-associated protein
OS=Oryza sativa subsp. japonica GN=P0417E03.30-2 PE=4
SV=1
Length = 460

Score = 191 bits (485), Expect = 2e-47
Identities = 98/178 (55%), Positives = 130/178 (73%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L ++K RL K+Q+L L++LWDLMD P ER F ++T A
Sbjct: 216 ISNDTLSKLDKTVATLNEDKKSRLSKLQELAGQLYDLWDLMDAPMQERSMFDHVTCNRSA 275

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
++V+ PG L+LD I QAE EVQR D LK SKMKE+ KKQ EL+D+YA AHM D A
Sbjct: 276 SVDKVTAPGALALDLIEQAEVEVQRLDQLKYSKMKEIAFKKQTELEDIYAGAHMVIDTAA 335

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+HE+ILA+IE+G + S ++A M+ +IS AKE+A SR+EILDK+E+W+SACEEESWLE
Sbjct: 336 AHEKILALIEAGNIEPSELIADMESQISKAKEEALSRKEILDKVERWMSACEEESWLE 393


>tr|Q5Z4M1|Q5Z4M1_ORYSJ Os06g0308300 protein OS=Oryza sativa subsp.
japonica GN=P0417E03.30-1 PE=2 SV=1
Length = 576

Score = 191 bits (485), Expect = 2e-47
Identities = 98/178 (55%), Positives = 130/178 (73%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L ++K RL K+Q+L L++LWDLMD P ER F ++T A
Sbjct: 216 ISNDTLSKLDKTVATLNEDKKSRLSKLQELAGQLYDLWDLMDAPMQERSMFDHVTCNRSA 275

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
++V+ PG L+LD I QAE EVQR D LK SKMKE+ KKQ EL+D+YA AHM D A
Sbjct: 276 SVDKVTAPGALALDLIEQAEVEVQRLDQLKYSKMKEIAFKKQTELEDIYAGAHMVIDTAA 335

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+HE+ILA+IE+G + S ++A M+ +IS AKE+A SR+EILDK+E+W+SACEEESWLE
Sbjct: 336 AHEKILALIEAGNIEPSELIADMESQISKAKEEALSRKEILDKVERWMSACEEESWLE 393


>tr|B8B123|B8B123_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_22696 PE=4 SV=1
Length = 859

Score = 191 bits (485), Expect = 2e-47
Identities = 98/178 (55%), Positives = 130/178 (73%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L ++K RL K+Q+L L++LWDLMD P ER F ++T A
Sbjct: 499 ISNDTLSKLDKTVATLNEDKKSRLSKLQELAGQLYDLWDLMDAPMQERSMFDHVTCNRSA 558

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
++V+ PG L+LD I QAE EVQR D LK SKMKE+ KKQ EL+D+YA AHM D A
Sbjct: 559 SVDKVTAPGALALDLIEQAEVEVQRLDQLKYSKMKEIAFKKQTELEDIYAGAHMVIDTAA 618

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+HE+ILA+IE+G + S ++A M+ +IS AKE+A SR+EILDK+E+W+SACEEESWLE
Sbjct: 619 AHEKILALIEAGNIEPSELIADMESQISKAKEEALSRKEILDKVERWMSACEEESWLE 676


>tr|Q9FEV8|Q9FEV8_TOBAC Microtubule-associated protein MAP65-1b
OS=Nicotiana tabacum GN=map65-1b PE=2 SV=1
Length = 584

Score = 190 bits (483), Expect = 4e-47
Identities = 94/178 (52%), Positives = 135/178 (75%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TL L TV +L ++K+RL K+Q+L T L +LW+LMDTP +ER F ++T I A
Sbjct: 224 ISNDTLSNLSRTVLALMEDKKQRLQKLQELATQLIDLWNLMDTPEEERSLFDHVTCNISA 283

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
+EVS PG L+LD I QAE EV+R D LKAS+MKE+ KKQA L++++A AH+E D +A
Sbjct: 284 SVDEVSIPGALALDLIEQAEVEVERLDQLKASRMKEIAFKKQAVLEEIFAHAHIEIDSEA 343

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ ++I+A+IESG + + +L MD++I A E+A+SR+EIL+K+EKW++ACEEESWLE
Sbjct: 344 ARQKIMALIESGNIEPAELLTDMDNQIVKANEEAHSRKEILEKVEKWMAACEEESWLE 401


>tr|A9T237|A9T237_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_139111 PE=4 SV=1
Length = 576

Score = 189 bits (480), Expect = 8e-47
Identities = 91/178 (51%), Positives = 138/178 (77%)
Frame = -2

Query: 534 ISDETLDGLKLTVQSLQHERKKRLHKIQDLGTSLFELWDLMDTPHDERRPFRNITNIIGA 355
IS++TLD L T+ SLQ E++KR+ KI++LGTS+ ELW LM+TP +ER+ F+++T +I A
Sbjct: 217 ISNKTLDCLGKTIHSLQAEKRKRVAKIKELGTSMMELWSLMETPVEERQIFQHVTCLISA 276

Query: 354 KENEVSGPGILSLDKICQAEEEVQRPDTLKASKMKELVLKKQAELDDVYAEAHMEPDPDA 175
E+E+SGP LS++ I +A+ EV+R D LK SKMKELV+KK+ EL++V AH+EPD +
Sbjct: 277 SEDEISGPSSLSVETIEEAQIEVERLDVLKKSKMKELVMKKRMELEEVCKSAHLEPDANT 336

Query: 174 SHEQILAIIESGLFDASSILATMDDKISIAKEKANSRREILDKIEKWISACEEESWLE 1
+ E+++A I+SG DA+ +LA ++++I AK + SR++I++ +EKW+SACEEE WLE
Sbjct: 337 AAEKLIAAIDSGTVDAAELLANLEEEIVTAKGEVASRKDIMNLMEKWMSACEEEGWLE 394