BP915617
Clone id YMU001_000073_F11
Library
Length 436
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCACTGTGGAGTTGGAAAGTGGGCAGACATCAAAAAGTTTTCTTTTTCGAACAGTGTCTC
TCGCTCTTCTACTGACCTAAAGGATAAATGGCGGAATCTAGTAAGAGCCAGTAATACACA
TTTTAAGATGGGAGGAAAGGTGGAAAGGCATCGAAAACATTCAGTTTCTCCGGTTCCAGG
ACCCATCCTGATACAAGTGCGCGAGCTGACAAAACAGGCTTTACCAGTAAATATTGTGAC
TGGAGTAAGCAGAACCGGCCGCAATGTGTCAAGAAAACAGATGATTTGAGATGCTTCTGT
TGTATAAAATGTATGGGTAAGTTATTGCCTACGACGTTCACACGGTGGCTGTCTGTATAA
GAAGACAGCAGACAGGTTTCAAGCAGATTTGGAAGCATGTAAAATGACTGTTGTATTGTG
TAATTTCACGTTTATG
■■Homology search results ■■ -
sp_hit_id P98164
Definition sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens
Align length 61
Score (bit) 30.8
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915617|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F11.
(436 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related pr... 31 2.5
sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans GN=catB P... 30 3.3
sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae GN=catB PE... 30 3.3
sp|Q92405|CATB_ASPFU Catalase B OS=Aspergillus fumigatus GN=catB... 30 3.3
sp|Q8X1P0|CATA_ERYGR Catalase OS=Erysiphe graminis subsp. hordei... 30 3.3
sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa GN=cat-3 PE... 30 3.3
sp|Q9Y7C2|CATB_AJECA Catalase B OS=Ajellomyces capsulata GN=CATB... 30 4.3
sp|P95539|CATE_PSEPU Catalase HPII OS=Pseudomonas putida GN=katE... 30 5.6
sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa GN=... 30 5.6
sp|Q55DH8|CATB_DICDI Catalase-B OS=Dictyostelium discoideum GN=c... 30 5.6
sp|P55305|CATA_EMENI Catalase A OS=Emericella nidulans GN=catA P... 30 5.6
sp|P78574|CATA_ASPFU Catalase A OS=Aspergillus fumigatus GN=catA... 30 5.6
sp|Q5DRE2|PCDC1_PANTR Protocadherin alpha-C1 OS=Pan troglodytes ... 30 5.7
sp|Q9H158|PCDC1_HUMAN Protocadherin alpha-C1 OS=Homo sapiens GN=... 30 5.7
sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo sa... 30 5.7
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos ta... 29 7.3
sp|P21179|CATE_ECOLI Catalase HPII OS=Escherichia coli (strain K... 29 9.6
sp|P24027|PA2C_CRODU Phospholipase A2 CB2 OS=Crotalus durissus t... 29 9.8
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=... 29 9.8

>sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein
2 OS=Homo sapiens GN=LRP2 PE=1 SV=3
Length = 4655

Score = 30.8 bits (68), Expect = 2.5
Identities = 19/61 (31%), Positives = 26/61 (42%)
Frame = -3

Query: 314 IHFIQQKHLKSSVFLTHCGRFCLLQSQYLLVKPVLSARALVSGWVLEPEKLNVFDAFPPF 135
+H +Q + + + C CLL SQ P + SGW L P+ LN PF
Sbjct: 1692 VHPSKQPNSVNPCAFSRCSHLCLLSSQ----GPHFYSCVCPSGWSLSPDLLNCLRDDQPF 1747

Query: 134 L 132
L
Sbjct: 1748 L 1748


>sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans GN=catB PE=2
SV=2
Length = 722

Score = 30.4 bits (67), Expect = 3.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 162 YTDEGNFDIVGNNIPVFFIQ 181


>sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae GN=catB PE=2
SV=1
Length = 725

Score = 30.4 bits (67), Expect = 3.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 163 YTDEGNFDIVGNNIPVFFIQ 182


>sp|Q92405|CATB_ASPFU Catalase B OS=Aspergillus fumigatus GN=catB
PE=1 SV=1
Length = 728

Score = 30.4 bits (67), Expect = 3.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 164 YTDEGNFDIVGNNIPVFFIQ 183


>sp|Q8X1P0|CATA_ERYGR Catalase OS=Erysiphe graminis subsp. hordei
GN=CAT1 PE=3 SV=1
Length = 718

Score = 30.4 bits (67), Expect = 3.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 165 YTDEGNFDIVGNNIPVFFIQ 184


>sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa GN=cat-3 PE=1
SV=1
Length = 719

Score = 30.4 bits (67), Expect = 3.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 164 YTDEGNFDIVGNNIPVFFIQ 183


>sp|Q9Y7C2|CATB_AJECA Catalase B OS=Ajellomyces capsulata GN=CATB
PE=2 SV=1
Length = 728

Score = 30.0 bits (66), Expect = 4.3
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 169 YTDEGNFDIVGNNVPVFFIQ 188


>sp|P95539|CATE_PSEPU Catalase HPII OS=Pseudomonas putida GN=katE
PE=3 SV=1
Length = 711

Score = 29.6 bits (65), Expect = 5.6
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 154 YTDEGNFDLVGNNMPVFFIQ 173


>sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa
GN=katE PE=3 SV=1
Length = 709

Score = 29.6 bits (65), Expect = 5.6
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 152 YTDEGNFDLVGNNMPVFFIQ 171


>sp|Q55DH8|CATB_DICDI Catalase-B OS=Dictyostelium discoideum GN=catB
PE=1 SV=1
Length = 692

Score = 29.6 bits (65), Expect = 5.6
Identities = 11/20 (55%), Positives = 15/20 (75%)
Frame = -3

Query: 359 YTDSHRVNVVGNNLPIHFIQ 300
YTD ++VGNN+P+ FIQ
Sbjct: 131 YTDEGNYDLVGNNMPVFFIQ 150


tr_hit_id A9T4W8
Definition tr|A9T4W8|A9T4W8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 95
Score (bit) 70.1
E-value 5.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915617|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F11.
(436 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T4W8|A9T4W8_PHYPA Predicted protein OS=Physcomitrella paten... 70 5e-11
tr|A9S2J5|A9S2J5_PHYPA Predicted protein OS=Physcomitrella paten... 69 1e-10
tr|Q8RXU8|Q8RXU8_ARATH Putative uncharacterized protein At1g1746... 64 5e-09
tr|Q3EBL5|Q3EBL5_ARATH Uncharacterized protein At2g37025.1 OS=Ar... 58 3e-07
tr|Q0WKW3|Q0WKW3_ARATH Putative uncharacterized protein OS=Arabi... 58 3e-07
tr|A7P6K5|A7P6K5_VITVI Chromosome chr9 scaffold_7, whole genome ... 58 3e-07
tr|A5AED8|A5AED8_VITVI Putative uncharacterized protein OS=Vitis... 58 3e-07
tr|A5AI08|A5AI08_VITVI Putative uncharacterized protein OS=Vitis... 56 8e-07
tr|Q6YZ61|Q6YZ61_ORYSJ Os02g0776700 protein OS=Oryza sativa subs... 54 4e-06
tr|Q6YZ60|Q6YZ60_ORYSJ MYB transcription factor-like OS=Oryza sa... 54 4e-06
tr|B8AJG9|B8AJG9_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|Q94AX9|Q94AX9_ARATH At1g72650/F28P22_16 (MYB transcription fa... 52 2e-05
tr|Q8LG08|Q8LG08_ARATH Putative uncharacterized protein OS=Arabi... 52 2e-05
tr|A7NZM8|A7NZM8_VITVI Chromosome chr6 scaffold_3, whole genome ... 50 4e-05
tr|A4RTW7|A4RTW7_OSTLU Predicted protein OS=Ostreococcus lucimar... 49 2e-04
tr|Q01D70|Q01D70_OSTTA Myb family transcription factor (ISS) OS=... 45 0.001
tr|A7PT53|A7PT53_VITVI Chromosome chr8 scaffold_29, whole genome... 45 0.002
tr|Q9CAI0|Q9CAI0_ARATH Putative uncharacterized protein F28P22.1... 40 0.044
tr|B2BGR6|B2BGR6_OLEEU Putative DNA binding protein (Fragment) O... 40 0.044
tr|A4S754|A4S754_OSTLU Predicted protein OS=Ostreococcus lucimar... 40 0.044
tr|Q00VD9|Q00VD9_OSTTA MYB transcription factor-like [Oryza sati... 39 0.17
tr|Q9LQJ9|Q9LQJ9_ARATH F28G4.5 protein OS=Arabidopsis thaliana G... 38 0.22
tr|Q9LNQ9|Q9LNQ9_ARATH F1L3.16 OS=Arabidopsis thaliana PE=4 SV=1 38 0.22
tr|Q84ZU4|Q84ZU4_NICGU Telomere binding protein TBP1 OS=Nicotian... 35 1.4
tr|B8AYT6|B8AYT6_ORYSI Putative uncharacterized protein OS=Oryza... 35 1.4
tr|A0ZPR8|A0ZPR8_TOBAC Telomere binding protein (Fragment) OS=Ni... 35 1.4
tr|A0JBS3|A0JBS3_SOLLC Telomere binding protein OS=Solanum lycop... 35 1.4
tr|Q01CT8|Q01CT8_OSTTA Homology to unknown gene (Fragment) OS=Os... 35 1.9
tr|Q9LL45|Q9LL45_ORYSA Telomere binding protein-1 OS=Oryza sativ... 35 2.4
tr|Q2LMD5|Q2LMD5_MALDO MYBR6 OS=Malus domestica PE=2 SV=1 35 2.4

>tr|A9T4W8|A9T4W8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_168075 PE=4 SV=1
Length = 929

Score = 70.1 bits (170), Expect = 5e-11
Identities = 41/95 (43%), Positives = 50/95 (52%), Gaps = 4/95 (4%)
Frame = +2

Query: 5 CGVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPGP 184
CG GKWADIKK DLKDKWRNL+RAS + ER +K + +P P
Sbjct: 663 CGGGKWADIKKLAFSNVGYRTAVDLKDKWRNLLRASRAQLHPAKQGER-KKQFTAAIPAP 721

Query: 185 ILIQVRELTKQALPVNIVT----GVSRTGRNVSRK 277
IL +VREL ++ T SR+GR V RK
Sbjct: 722 ILARVRELAALQNQISPTTETGSSTSRSGRTVHRK 756


>tr|A9S2J5|A9S2J5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162465 PE=4 SV=1
Length = 759

Score = 68.9 bits (167), Expect = 1e-10
Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 4/95 (4%)
Frame = +2

Query: 5 CGVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPGP 184
CG GKWADIKK DLKDKWRNL+RAS + ER +K + +P P
Sbjct: 666 CGGGKWADIKKLAFSNVGYRTAVDLKDKWRNLLRASRAQLHPAKQGER-KKQFTAAIPAP 724

Query: 185 ILIQVRELTKQALPVNIVTGVS----RTGRNVSRK 277
IL +VREL ++ G R+GR V RK
Sbjct: 725 ILARVRELAALQNQISPTAGTGSSTIRSGRTVHRK 759


>tr|Q8RXU8|Q8RXU8_ARATH Putative uncharacterized protein At1g17460
(MYB transcription factor) OS=Arabidopsis thaliana
GN=At1g17460 PE=2 SV=1
Length = 604

Score = 63.5 bits (153), Expect = 5e-09
Identities = 33/82 (40%), Positives = 47/82 (57%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPGPI 187
GVGKW +IKK DLKDKWRNL +AS+++ GG +KH +P I
Sbjct: 515 GVGKWTEIKKLSFSPYTHRTTVDLKDKWRNLQKASSSNRMEGGL----KKHGSMAIPTHI 570

Query: 188 LIQVRELTKQALPVNIVTGVSR 253
++QVREL ++ P++ V +R
Sbjct: 571 MLQVRELAQKQSPISRVVSKAR 592


>tr|Q3EBL5|Q3EBL5_ARATH Uncharacterized protein At2g37025.1
OS=Arabidopsis thaliana GN=At2g37025 PE=4 SV=1
Length = 410

Score = 57.8 bits (138), Expect = 3e-07
Identities = 29/69 (42%), Positives = 36/69 (52%)
Frame = +2

Query: 2 HCGVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPG 181
H GVGKW DIK D++DKWRNL++AS G+ E RK +P
Sbjct: 309 HFGVGKWTDIKNHFFHYAAHRKPVDIRDKWRNLLKASYNEKHNDGQAEEKRKSVARSIPK 368

Query: 182 PILIQVREL 208
IL +VREL
Sbjct: 369 DILHRVREL 377


>tr|Q0WKW3|Q0WKW3_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 410

Score = 57.8 bits (138), Expect = 3e-07
Identities = 29/69 (42%), Positives = 36/69 (52%)
Frame = +2

Query: 2 HCGVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPG 181
H GVGKW DIK D++DKWRNL++AS G+ E RK +P
Sbjct: 309 HFGVGKWTDIKNHFFHYAAHRKPVDIRDKWRNLLKASYNEKHNDGQAEEKRKSVARSIPK 368

Query: 182 PILIQVREL 208
IL +VREL
Sbjct: 369 DILHRVREL 377


>tr|A7P6K5|A7P6K5_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034106001
PE=4 SV=1
Length = 562

Score = 57.8 bits (138), Expect = 3e-07
Identities = 32/82 (39%), Positives = 42/82 (51%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPGPI 187
G G+W++IK+ DLKDKWRNL+RAS K RKH P+P I
Sbjct: 465 GAGRWSEIKRLAFASYSYRTSVDLKDKWRNLLRASFA-LSPAEKGMSSRKHGSMPIPAAI 523

Query: 188 LIQVRELTKQALPVNIVTGVSR 253
L++VREL + V G S+
Sbjct: 524 LLKVRELAEMHAQVAPNLGTSK 545


>tr|A5AED8|A5AED8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005454 PE=4 SV=1
Length = 867

Score = 57.8 bits (138), Expect = 3e-07
Identities = 32/82 (39%), Positives = 42/82 (51%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHFKMGGKVERHRKHSVSPVPGPI 187
G G+W++IK+ DLKDKWRNL+RAS K RKH P+P I
Sbjct: 770 GAGRWSEIKRLAFASYSYRTSVDLKDKWRNLLRASFA-LSPAEKGMSSRKHGSMPIPAAI 828

Query: 188 LIQVRELTKQALPVNIVTGVSR 253
L++VREL + V G S+
Sbjct: 829 LLKVRELAEMHAQVAPNLGTSK 850


>tr|A5AI08|A5AI08_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006318 PE=4 SV=1
Length = 587

Score = 56.2 bits (134), Expect = 8e-07
Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 5/72 (6%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHF----KMGGK-VERHRKHSVSP 172
GVG+W +IK+ DLKDKWRNL+RAS T ++G K VE+ RKH+
Sbjct: 477 GVGRWTEIKRLLFSSSTHRTSVDLKDKWRNLLRASCTRLHNKREVGLKLVEQGRKHASHQ 536

Query: 173 VPGPILIQVREL 208
+P +L +VREL
Sbjct: 537 IPQSVLGRVREL 548


>tr|Q6YZ61|Q6YZ61_ORYSJ Os02g0776700 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0013K01.35-1 PE=2 SV=1
Length = 621

Score = 53.9 bits (128), Expect = 4e-06
Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHF--KMGGKVERHRKHSVSPVPG 181
G GKW++I++ DLKDKWRNL+RAS T + G R S P+P
Sbjct: 521 GAGKWSEIRRLAFSSYSYRTSVDLKDKWRNLIRASQTQLSTENDGVCPRKSNPSAIPIPV 580

Query: 182 PILIQVRELTK 214
IL++V++L +
Sbjct: 581 SILLRVKKLAE 591


>tr|Q6YZ60|Q6YZ60_ORYSJ MYB transcription factor-like OS=Oryza
sativa subsp. japonica GN=OSJNBb0013K01.35-2 PE=4 SV=1
Length = 409

Score = 53.9 bits (128), Expect = 4e-06
Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
Frame = +2

Query: 8 GVGKWADIKKFXXXXXXXXXXTDLKDKWRNLVRASNTHF--KMGGKVERHRKHSVSPVPG 181
G GKW++I++ DLKDKWRNL+RAS T + G R S P+P
Sbjct: 309 GAGKWSEIRRLAFSSYSYRTSVDLKDKWRNLIRASQTQLSTENDGVCPRKSNPSAIPIPV 368

Query: 182 PILIQVRELTK 214
IL++V++L +
Sbjct: 369 SILLRVKKLAE 379