BP915618
Clone id YMU001_000073_F12
Library
Length 456
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGTACCTGCGCAAAGTCATCCACATCTATAACTTTGAAATGTATAAACTTGGTAATTCT
AAAGTATTTCATTGAGAAGGGATTTTGAACAGGAAAGGAAGCTATAGCACACTGTTGTAG
ATGAGTTGATGGAGAAGGCTATGCCATCCTCACATGATAGTACTTCTCGTACTTAATAAC
ATCATTACACTTTATAGTCAATTATTATGTTTATTTGTCTAATTGTGTGCCGTTACTTTC
TTAGATATAGGTGGATCTGTCAATTGCGTCATGTCTTTACATTTGATTATCTAGATAATG
TCTCGATGCATGGTCATATTAGACATGATTTTGATCAGAGTATTGCTGTCACTGGGGATT
ACATTGTCATTTCTGGAGATTTAACATTGGAGGTAAGGTCTCCATCTTGGGCTATGATTC
ATGAGCATATGCTCAAGGCCTGGCCAAGTGATCTTG
■■Homology search results ■■ -
sp_hit_id P32501
Definition sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae
Align length 40
Score (bit) 30.0
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915618|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F12.
(456 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subun... 30 4.9
sp|P61037|LNT1_TREDE Apolipoprotein N-acyltransferase 1 OS=Trepo... 29 8.4
sp|P23129|ODO1_BACSU 2-oxoglutarate dehydrogenase E1 component O... 29 8.6

>sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit
epsilon OS=Saccharomyces cerevisiae GN=GCD6 PE=1 SV=1
Length = 712

Score = 30.0 bits (66), Expect = 4.9
Identities = 12/40 (30%), Positives = 20/40 (50%)
Frame = +3

Query: 312 GHIRHDFDQSIAVTGDYIVISGDLTLEVRSPSWAMIHEHM 431
G + D D +TGD+I++SGD+ + H+ M
Sbjct: 116 GDVMRDLDNRGIITGDFILVSGDVLTNIDFSKMLEFHKKM 155


>sp|P61037|LNT1_TREDE Apolipoprotein N-acyltransferase 1
OS=Treponema denticola GN=lnt1 PE=3 SV=1
Length = 544

Score = 29.3 bits (64), Expect = 8.4
Identities = 13/40 (32%), Positives = 22/40 (55%)
Frame = +3

Query: 198 SIIMFICLIVCRYFLRYRWICQLRHVFTFDYLDNVSMHGH 317
S++ F+ I+ YF RY +I Q F+YL+ + G+
Sbjct: 97 SVLFFVLKIIDSYFSRYSFIFQTIAWVAFEYLNTLGFLGY 136


>sp|P23129|ODO1_BACSU 2-oxoglutarate dehydrogenase E1 component
OS=Bacillus subtilis GN=odhA PE=3 SV=2
Length = 941

Score = 29.3 bits (64), Expect = 8.6
Identities = 14/39 (35%), Positives = 20/39 (51%)
Frame = -1

Query: 183 DVIKYEKYYHVRMA*PSPSTHLQQCAIASFPVQNPFSMK 67
D+I Y +Y H M PS + + A+ P N FS+K
Sbjct: 455 DLIGYRRYGHNEMDEPSTTQPMLYDAVRKHPTSNKFSLK 493


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915618|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_F12.
(456 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******