BP915639
Clone id YMU001_000073_H11
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000073_H11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATTCGCGGCCGCGAATTCTTCCAGAATCTCTCCCTCCTCTGCATCTGGGGAAAGGGGCC
CCTCATCATGAGCATAATCACAAGATCCATGGGCGCCATTGCCAGGCCTCTCTACTACAG
GACTCTGGGTTAGGTCATCCTGTTCTTGAGATAAGACAGCCGGTAATGTGGGACGTAGGG
TCTCTACAGCAGTCACCGAAACCTCAACTGTGCTGACAGAACTATACGCAGAAACCATGT
CTGTGACCATCTCCACATATGCTTCCTTTTCTGCTGTGTCACGGTGCTTGATTTCCTGCT
CCTGCTGATTTTGCAGACTAGCAACAGCATTTTCTTCATCTTCGTCCTCTTCCTCATCTT
CTTCATCATCACCTTCGTCGTTGTAAAGTGAGAGGAGCGCAATGCCTTCTGCTTTGCGTT
TGCTTGCTGCCATGGTACAAATGATTATTGAAAATCAAGTAAGTTCTCTTAACTCTGTGC
CGCGTGTCTGAGAATATGCAGAGGCAAACTCTCTCCCTCTCCTCTCTCTC
■■Homology search results ■■ -
sp_hit_id Q9CY24
Definition sp|Q9CY24|T179B_MOUSE Transmembrane protein 179B OS=Mus musculus
Align length 59
Score (bit) 32.0
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915639|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_H11.
(505 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CY24|T179B_MOUSE Transmembrane protein 179B OS=Mus musculus... 32 1.7
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis... 32 2.2
sp|Q86IK1|Y8872_DICDI Uncharacterized protein DDB_G0272724 OS=Di... 31 3.7
sp|Q9Q927|NTP2_RFVKA Nucleoside triphosphatase II OS=Rabbit fibr... 31 3.8
sp|P31902|HYPB_RALEH Hydrogenase nickel incorporation protein hy... 30 4.9
sp|Q9A5C1|SYA_CAUCR Alanyl-tRNA synthetase OS=Caulobacter cresce... 30 8.4
sp|Q86ZK8|SEC24_PODAN Protein transport protein SEC24 OS=Podospo... 30 8.4
sp|A4QUL1|SEC24_MAGGR Protein transport protein SEC24 OS=Magnapo... 30 8.4

>sp|Q9CY24|T179B_MOUSE Transmembrane protein 179B OS=Mus musculus
GN=Tmem179b PE=2 SV=1
Length = 219

Score = 32.0 bits (71), Expect = 1.7
Identities = 17/59 (28%), Positives = 30/59 (50%)
Frame = +2

Query: 101 WVRSSCS*DKTAGNVGRRVSTAVTETSTVLTELYAETMSVTISTYASFSAVSRCLISCS 277
WV SSC D G++G R++ A++ T+ L + A + +++ + ISCS
Sbjct: 84 WVYSSCIEDSHRGSIGLRIALAISATAIFLILVSACILRFGTNSFCNSIISLNLTISCS 142


>sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis
GN=zic5 PE=2 SV=1
Length = 515

Score = 31.6 bits (70), Expect = 2.2
Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
Frame = +3

Query: 18 HLGKGAPHHEHNHKIHGRHCQA--SLLQDSGLGHPV 119
H G+PHH H+H H + S G+GHP+
Sbjct: 151 HPAAGSPHHHHHHHPHSMFISSTGSYAHPEGVGHPL 186


>sp|Q86IK1|Y8872_DICDI Uncharacterized protein DDB_G0272724
OS=Dictyostelium discoideum GN=DDB_G0272724 PE=4 SV=1
Length = 104

Score = 30.8 bits (68), Expect = 3.7
Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
Frame = +3

Query: 39 HHEHNHKIHGRHCQASLLQDSGL-GHPVLEIRQPVM 143
HH H+H HG H ++ +G+ G PV+ + QP++
Sbjct: 3 HHHHHHGHHGHHHHDTITYTTGVYGAPVVPMVQPMV 38


>sp|Q9Q927|NTP2_RFVKA Nucleoside triphosphatase II OS=Rabbit fibroma
virus (strain Kasza) GN=NPH2 PE=3 SV=1
Length = 678

Score = 30.8 bits (68), Expect = 3.8
Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Frame = -1

Query: 499 EERERVCLCIFSDTRHRVKRTYLIFNNHLYHGSKQTQSR-RHCAPLTL 359
+ERER F +HR Y++ +NH++ + +T R R P TL
Sbjct: 33 DERERFKYATFPIIKHRWSHAYVVKDNHVFKLNVETSKRLRRATPPTL 80


>sp|P31902|HYPB_RALEH Hydrogenase nickel incorporation protein hypB
OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428
/ Stanier 337) GN=hypB PE=3 SV=2
Length = 361

Score = 30.4 bits (67), Expect = 4.9
Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 6/50 (12%)
Frame = +3

Query: 24 GKGAPHHEHNHKIHGRHCQASLLQDSGLGHPVLEIRQ------PVMWDVG 155
G+ + HH+H H H H S SG+G VL I P MWD+G
Sbjct: 194 GQHSHHHDHEHARHDHHDHRS----SGIG-SVLFIENVGNLVCPAMWDLG 238


>sp|Q9A5C1|SYA_CAUCR Alanyl-tRNA synthetase OS=Caulobacter
crescentus GN=alaS PE=3 SV=1
Length = 880

Score = 29.6 bits (65), Expect = 8.4
Identities = 14/35 (40%), Positives = 18/35 (51%)
Frame = -2

Query: 111 DLTQSPVVERPGNGAHGSCDYAHDEGPLSPDAEEG 7
DL ++ V+ G GA G D+A P AEEG
Sbjct: 836 DLAKAAVIAMGGQGAGGKADFAQGGAPDDSKAEEG 870


>sp|Q86ZK8|SEC24_PODAN Protein transport protein SEC24 OS=Podospora
anserina GN=SEC24 PE=3 SV=1
Length = 946

Score = 29.6 bits (65), Expect = 8.4
Identities = 15/38 (39%), Positives = 20/38 (52%)
Frame = +2

Query: 152 RVSTAVTETSTVLTELYAETMSVTISTYASFSAVSRCL 265
RV T T+T L ++YA I+TY + AV R L
Sbjct: 662 RVMTLALPTTTNLADVYASADQAAITTYYTHKAVERAL 699


>sp|A4QUL1|SEC24_MAGGR Protein transport protein SEC24
OS=Magnaporthe grisea GN=SEC24 PE=3 SV=1
Length = 959

Score = 29.6 bits (65), Expect = 8.4
Identities = 16/40 (40%), Positives = 21/40 (52%)
Frame = +2

Query: 152 RVSTAVTETSTVLTELYAETMSVTISTYASFSAVSRCLIS 271
RV T T+T L ++YA I+TY S AV + L S
Sbjct: 675 RVITLALPTTTNLADVYASADQCAITTYFSHKAVEKALSS 714


tr_hit_id B2ZAT6
Definition tr|B2ZAT6|B2ZAT6_9ROSI Predicted protein OS=Gossypioides kirkii
Align length 138
Score (bit) 48.5
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915639|Adiantum capillus-veneris mRNA, clone:
YMU001_000073_H11.
(505 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2ZAT6|B2ZAT6_9ROSI Predicted protein OS=Gossypioides kirkii ... 49 2e-04
tr|Q6DXS9|Q6DXS9_GOSHI Predicted protein OS=Gossypium hirsutum P... 45 0.002
tr|Q6DXR5|Q6DXR5_GOSHI Predicted protein OS=Gossypium hirsutum P... 43 0.010
tr|A7QDI5|A7QDI5_VITVI Chromosome chr10 scaffold_81, whole genom... 40 0.049
tr|A5AJ97|A5AJ97_VITVI Putative uncharacterized protein OS=Vitis... 40 0.049
tr|B6TMA7|B6TMA7_MAIZE Transcription regulator OS=Zea mays PE=2 ... 35 2.7
tr|Q11XI2|Q11XI2_CYTH3 CHU large protein; uncharacterized OS=Cyt... 33 6.0
tr|Q4H3D3|Q4H3D3_CIOIN Transcription factor protein OS=Ciona int... 33 9.9

>tr|B2ZAT6|B2ZAT6_9ROSI Predicted protein OS=Gossypioides kirkii
PE=4 SV=1
Length = 428

Score = 48.5 bits (114), Expect = 2e-04
Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 2/138 (1%)
Frame = -2

Query: 408 MAASKRKAEGIALLSLYNXXXXXXXXXXXXXXXENAVASLQNQQEQEIKHRDTAEKEAYV 229
MA+ K+++EGIALLS+YN + + ++EQ+++ + E+ Y
Sbjct: 1 MASRKKESEGIALLSMYNDEDDEEMGDIEEGDHRQNEQAGE-EEEQQLEGQPLEEENEYR 59

Query: 228 EMVTDMXXXXXXXXXXXXXXXXXXTL--RPTLPAVLSQEQDDLTQSPVVERPGNGAHGSC 55
E + +M L + P+V S +Q S +R G G
Sbjct: 60 ESINNMEEDSRTNDNTPPFPHQNSNLSQQQQEPSVSSPQQPQPLVSS--KRSGGGRLTIV 117

Query: 54 DYAHDEGPLSPDAEEGEI 1
DY HDE +SP+ EEGE+
Sbjct: 118 DYGHDEAAMSPEPEEGEL 135


>tr|Q6DXS9|Q6DXS9_GOSHI Predicted protein OS=Gossypium hirsutum PE=4
SV=1
Length = 425

Score = 45.4 bits (106), Expect = 0.002
Identities = 42/143 (29%), Positives = 59/143 (41%), Gaps = 7/143 (4%)
Frame = -2

Query: 408 MAASKRKAEGIALLSLYNXXXXXXXXXXXXXXXENAVASLQNQQ-----EQEIKHRDTAE 244
MA+ K+++EGIALLS+YN QNQQ EQ+ + + E
Sbjct: 1 MASRKKESEGIALLSMYNDEDDEEMGDIEEGDHR------QNQQTGEEEEQQQEGQPLEE 54

Query: 243 KEAYVEMVTDMXXXXXXXXXXXXXXXXXXTL--RPTLPAVLSQEQDDLTQSPVVERPGNG 70
+ Y E +M L + P+V S +Q S +R G G
Sbjct: 55 ENDYRESNNNMEEDSRTNDNTPPFPHQNTILSQQQQEPSVSSPQQPQTLVSS--KRSGGG 112

Query: 69 AHGSCDYAHDEGPLSPDAEEGEI 1
DY HDE +SP+ EEGE+
Sbjct: 113 RLTIVDYGHDEAAMSPEPEEGEL 135


>tr|Q6DXR5|Q6DXR5_GOSHI Predicted protein OS=Gossypium hirsutum PE=4
SV=1
Length = 428

Score = 42.7 bits (99), Expect = 0.010
Identities = 44/145 (30%), Positives = 61/145 (42%), Gaps = 9/145 (6%)
Frame = -2

Query: 408 MAASKRKAEGIALLSLYNXXXXXXXXXXXXXXXENAVASLQNQQ--EQEIKHRD---TAE 244
MA+ K+++EGIALLS+YN QNQQ E+E K ++ E
Sbjct: 1 MASRKKESEGIALLSMYNDEDDEEMGDIEEGDHR------QNQQTGEEEEKQQEGQPLEE 54

Query: 243 KEAYVEMVTDMXXXXXXXXXXXXXXXXXXTL--RPTLPAVLSQEQDDLTQSPVV--ERPG 76
+ Y E +M L + P+V S +Q P V +R G
Sbjct: 55 ENEYRESNNNMEEDSRTNDNTPPFPHQNTNLSQQQQEPSVSSPQQPQ----PFVASKRSG 110

Query: 75 NGAHGSCDYAHDEGPLSPDAEEGEI 1
G DY HDE +SP+ EEGE+
Sbjct: 111 GGRLTIVDYGHDETAMSPEPEEGEL 135


>tr|A7QDI5|A7QDI5_VITVI Chromosome chr10 scaffold_81, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035853001
PE=4 SV=1
Length = 404

Score = 40.4 bits (93), Expect = 0.049
Identities = 34/138 (24%), Positives = 58/138 (42%), Gaps = 2/138 (1%)
Frame = -2

Query: 408 MAASKRKAEGIALLSLYNXXXXXXXXXXXXXXXENAVASLQNQQEQEIKHRD--TAEKEA 235
MA+ K++ EGI+LL++YN + ++N+++ + D +++E
Sbjct: 1 MASKKKEFEGISLLAVYNDED---------------MDDIENEEDGDDTEEDLKNSDREV 45

Query: 234 YVEMVTDMXXXXXXXXXXXXXXXXXXTLRPTLPAVLSQEQDDLTQSPVVERPGNGAHGSC 55
E + + +P+ Q L S ++PG G
Sbjct: 46 NYENTPPLLDVNSTPKTTPQ--------QAQIPSSSPLPQPMLLDS---QKPGRGRLTIV 94

Query: 54 DYAHDEGPLSPDAEEGEI 1
DY HDE +SP+AEEGEI
Sbjct: 95 DYGHDESAMSPEAEEGEI 112


>tr|A5AJ97|A5AJ97_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006336 PE=4 SV=1
Length = 586

Score = 40.4 bits (93), Expect = 0.049
Identities = 34/138 (24%), Positives = 58/138 (42%), Gaps = 2/138 (1%)
Frame = -2

Query: 408 MAASKRKAEGIALLSLYNXXXXXXXXXXXXXXXENAVASLQNQQEQEIKHRD--TAEKEA 235
MA+ K++ EGI+LL++YN + ++N+++ + D +++E
Sbjct: 1 MASKKKEFEGISLLAVYNDED---------------MDDIENEEDGDDTEEDLKNSDREV 45

Query: 234 YVEMVTDMXXXXXXXXXXXXXXXXXXTLRPTLPAVLSQEQDDLTQSPVVERPGNGAHGSC 55
E + + +P+ Q L S ++PG G
Sbjct: 46 NYENTPPLLDVNSTPKTTPQ--------QAQIPSSSPLPQPMLLDS---QKPGRGRLTIV 94

Query: 54 DYAHDEGPLSPDAEEGEI 1
DY HDE +SP+AEEGEI
Sbjct: 95 DYGHDESAMSPEAEEGEI 112


>tr|B6TMA7|B6TMA7_MAIZE Transcription regulator OS=Zea mays PE=2
SV=1
Length = 441

Score = 34.7 bits (78), Expect = 2.7
Identities = 15/27 (55%), Positives = 18/27 (66%)
Frame = -2

Query: 81 PGNGAHGSCDYAHDEGPLSPDAEEGEI 1
P GA DYAHDE +SP+ E+GEI
Sbjct: 121 PRRGALAIVDYAHDETAMSPEQEDGEI 147


>tr|Q11XI2|Q11XI2_CYTH3 CHU large protein; uncharacterized
OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB
9469) GN=CHU_0597 PE=4 SV=1
Length = 1547

Score = 33.5 bits (75), Expect = 6.0
Identities = 25/73 (34%), Positives = 31/73 (42%), Gaps = 7/73 (9%)
Frame = +2

Query: 74 LPGLSTTGLWVRSSCS*DKTAGNVGRRVSTAVTET-------STVLTELYAETMSVTIST 232
LP T LW + + D T G TA S V+TEL T+S+T T
Sbjct: 805 LPSPGATVLWNNGATTNDITVNTAGTYTVTATDANLCASLPKSVVVTELAVPTLSLTNGT 864

Query: 233 YASFSAVSRCLIS 271
ASF A L+S
Sbjct: 865 TASFCADKDILLS 877


>tr|Q4H3D3|Q4H3D3_CIOIN Transcription factor protein OS=Ciona
intestinalis GN=Ci-HNF6 PE=2 SV=1
Length = 764

Score = 32.7 bits (73), Expect = 9.9
Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 4/55 (7%)
Frame = +3

Query: 9 PPLHLGKGAPHHEHNHKIHGRH----CQASLLQDSGLGHPVLEIRQPVMWDVGSL 161
P HL PHH H+H +H + AS L SGL HP Q + DV L
Sbjct: 706 PSGHLHFPPPHHLHHHNLHQQQQNTMLSASHLTSSGLVHPYQSQHQLLGSDVTGL 760