BP915646
Clone id YMU001_000074_A10
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGCTCAAGATGGGGTGAAGTTGTGGGATTTGCGGAAGCTTAAAAATTTTCGGTCCTTTT
CACCGATATGATGCCAATACACCAACTAATGCAGTGGAGTTCGATTTCAGTGGGAATTAC
CTTGCTATTGCTGGTTCAGATGTAAGGATTTATCAAGTATCGGGTGTTAAACAGGATTGG
AACACTATCAAGGTTTTACCCGATCTCTCAGGGACAGGCAAAGTCACCTCTGTCAGATTT
GGGCCACTTGCGAAGTACGTGGCAACTGGAACTGGGGACCGAACTCTAAGAATATTTGGT
GTCCCTGTTGCATCATTAGAGGCTTGATCTATAGGGGAGCAATGGCACTTTGATTTGTGG
ACGTAACCGAAGAGATGTGTGCGTACGGGACATTGACCTTGGGGTGCACGCGATGACTTG
ATTTCTCTATGGTTTTTATCTCAATCTGGTGGGCTAGTTGTGTCTGGTTACCCCTTTCTA
TTTGTTGTGAGATGAGAGCGAATTCAGCTGTGTAAAAGGTACTCTGGGCA
■■Homology search results ■■ -
sp_hit_id Q94BR4
Definition sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana
Align length 89
Score (bit) 104.0
E-value 6.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915646|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_A10.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS... 104 6e-28
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS... 89 2e-23
sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 homolog OS=C... 49 1e-09
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norv... 47 1e-08
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus muscu... 47 1e-08
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapi... 47 1e-08
sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus ga... 47 1e-08
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos tauru... 47 1e-08
sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae GN... 42 0.002
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans GN=hir1... 40 0.005
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizos... 39 0.012
sp|Q4P9P9|NUDF_USTMA Nuclear distribution protein PAC1 OS=Ustila... 39 0.012
sp|Q6FVD3|HIR1_CANGA Protein HIR1 OS=Candida glabrata GN=HIR1 PE... 39 0.020
sp|Q0VA16|WDR70_XENTR WD repeat-containing protein 70 OS=Xenopus... 37 0.045
sp|Q5BK30|WDR69_RAT WD repeat-containing protein 69 OS=Rattus no... 37 0.059
sp|Q8YRI1|YY46_ANASP Uncharacterized WD repeat-containing protei... 37 0.077
sp|Q5XIG8|STRAP_RAT Serine-threonine kinase receptor-associated ... 37 0.077
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associate... 37 0.077
sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associate... 37 0.077
sp|Q6GPP0|WDR70_XENLA WD repeat-containing protein 70 OS=Xenopus... 36 0.10
sp|Q8N136|WDR69_HUMAN WD repeat-containing protein 69 OS=Homo sa... 36 0.10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospo... 36 0.10
sp|Q9C270|PWP2_NEUCR Periodic tryptophan protein 2 homolog OS=Ne... 30 0.15
sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associate... 35 0.17
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe G... 35 0.17
sp|Q0CQ54|HIR1_ASPTN Protein hir1 OS=Aspergillus terreus (strain... 35 0.17
sp|Q4R8E7|WDR69_MACFA WD repeat-containing protein 69 OS=Macaca ... 35 0.29
sp|Q5ZL33|STRAP_CHICK Serine-threonine kinase receptor-associate... 35 0.29
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizos... 30 0.34
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated... 34 0.38

>sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1
OS=Arabidopsis thaliana GN=PUB59 PE=2 SV=1
Length = 523

Score = 104 bits (260), Expect(2) = 6e-28
Identities = 53/89 (59%), Positives = 65/89 (73%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
LK F F DAN+ VEFD SG+YL IA SD+R++Q + VK +WN IK LPDLSGTG
Sbjct: 427 LKNFRTFDFPDANS----VEFDHSGSYLGIAASDIRVFQAASVKAEWNPIKTLPDLSGTG 482

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
K TSV+FG +KY+A G+ DR LRIFG+P
Sbjct: 483 KATSVKFGLDSKYIAVGSMDRNLRIFGLP 511



Score = 38.5 bits (88), Expect(2) = 6e-28
Identities = 16/19 (84%), Positives = 18/19 (94%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSF 59
A DGV+LWDLRKLKNFR+F
Sbjct: 415 ALDGVRLWDLRKLKNFRTF 433


>sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2
OS=Arabidopsis thaliana GN=PUB60 PE=2 SV=2
Length = 565

Score = 89.4 bits (220), Expect(2) = 2e-23
Identities = 46/81 (56%), Positives = 57/81 (70%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F F DAN+ VEFD SG+YL IA SD+++YQ + VK +WN IK LPDLSGTG
Sbjct: 426 LRNFKSFLSADANS----VEFDPSGSYLGIAASDIKVYQTASVKAEWNLIKTLPDLSGTG 481

Query: 220 KVTSVRFGPLAKYVATGTGDR 282
K T V+FG A+YVA G+ DR
Sbjct: 482 KATCVKFGSDAQYVAVGSMDR 502



Score = 38.9 bits (89), Expect(2) = 2e-23
Identities = 15/19 (78%), Positives = 19/19 (100%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSF 59
A+DGV+LWDLRKL+NF+SF
Sbjct: 414 AEDGVRLWDLRKLRNFKSF 432


>sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 homolog
OS=Caenorhabditis elegans GN=T10F2.4 PE=2 SV=2
Length = 492

Score = 48.9 bits (115), Expect(2) = 1e-09
Identities = 27/72 (37%), Positives = 42/72 (58%)
Frame = +1

Query: 82 PTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPLAKYV 261
P N++ FD +G +L I G V++ V + W+ + L D SG VT VRFG A+ +
Sbjct: 425 PINSLSFDMTGTFLGIGGQKVQVLHV----KSWSEVVSLSDHSGP--VTGVRFGENARSL 478

Query: 262 ATGTGDRTLRIF 297
T + D++LR+F
Sbjct: 479 VTCSLDKSLRVF 490



Score = 32.3 bits (72), Expect(2) = 1e-09
Identities = 14/21 (66%), Positives = 19/21 (90%), Gaps = 1/21 (4%)
Frame = +3

Query: 3 AQDG-VKLWDLRKLKNFRSFS 62
++DG VKLWDLRKLKN ++F+
Sbjct: 399 SEDGEVKLWDLRKLKNLKTFA 419


>sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus
norvegicus GN=Prpf19 PE=2 SV=2
Length = 504

Score = 47.0 bits (110), Expect(2) = 1e-08
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = +1

Query: 70 DANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPL 249
D N ++ FD SG YLA+ G+DV+IY + + W ++L +G T V FG
Sbjct: 433 DNNFEVKSLIFDQSGTYLALGGTDVQIY----ICKQWT--EILHFTEHSGLTTGVAFGHH 486

Query: 250 AKYVATGTGDRTLRIFGV 303
AK++A+ DR+L+ + +
Sbjct: 487 AKFIASTGMDRSLKFYSL 504



Score = 30.8 bits (68), Expect(2) = 1e-08
Identities = 12/14 (85%), Positives = 14/14 (100%)
Frame = +3

Query: 15 VKLWDLRKLKNFRS 56
VKLWDLRKLKNF++
Sbjct: 416 VKLWDLRKLKNFKT 429



Score = 34.3 bits (77), Expect = 0.38
Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
Frame = +1

Query: 115 NYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTGDRTLR 291
N + G+D + V D +T ++L L G T KVTSV F P + V + + D T+R
Sbjct: 235 NKILTGGADKNV-----VVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIR 289

Query: 292 IFGVPVAS 315
I+ VP S
Sbjct: 290 IWSVPNTS 297


>sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus
GN=Prpf19 PE=2 SV=1
Length = 504

Score = 47.0 bits (110), Expect(2) = 1e-08
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = +1

Query: 70 DANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPL 249
D N ++ FD SG YLA+ G+DV+IY + + W ++L +G T V FG
Sbjct: 433 DNNFEVKSLIFDQSGTYLALGGTDVQIY----ICKQWT--EILHFTEHSGLTTGVAFGHH 486

Query: 250 AKYVATGTGDRTLRIFGV 303
AK++A+ DR+L+ + +
Sbjct: 487 AKFIASTGMDRSLKFYSL 504



Score = 30.8 bits (68), Expect(2) = 1e-08
Identities = 12/14 (85%), Positives = 14/14 (100%)
Frame = +3

Query: 15 VKLWDLRKLKNFRS 56
VKLWDLRKLKNF++
Sbjct: 416 VKLWDLRKLKNFKT 429



Score = 34.3 bits (77), Expect = 0.38
Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
Frame = +1

Query: 115 NYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTGDRTLR 291
N + G+D + V D +T ++L L G T KVTSV F P + V + + D T+R
Sbjct: 235 NKILTGGADKNV-----VVFDKSTEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIR 289

Query: 292 IFGVPVAS 315
I+ VP S
Sbjct: 290 IWSVPNTS 297


>sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens
GN=PRPF19 PE=1 SV=1
Length = 504

Score = 47.0 bits (110), Expect(2) = 1e-08
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = +1

Query: 70 DANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPL 249
D N ++ FD SG YLA+ G+DV+IY + + W ++L +G T V FG
Sbjct: 433 DNNFEVKSLIFDQSGTYLALGGTDVQIY----ICKQWT--EILHFTEHSGLTTGVAFGHH 486

Query: 250 AKYVATGTGDRTLRIFGV 303
AK++A+ DR+L+ + +
Sbjct: 487 AKFIASTGMDRSLKFYSL 504



Score = 30.8 bits (68), Expect(2) = 1e-08
Identities = 12/14 (85%), Positives = 14/14 (100%)
Frame = +3

Query: 15 VKLWDLRKLKNFRS 56
VKLWDLRKLKNF++
Sbjct: 416 VKLWDLRKLKNFKT 429



Score = 33.5 bits (75), Expect = 0.65
Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
Frame = +1

Query: 115 NYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTGDRTLR 291
N + G+D + V D ++ ++L L G T KVTSV F P V + + D T+R
Sbjct: 235 NKILTGGADKNV-----VVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIR 289

Query: 292 IFGVPVAS 315
I+ VP AS
Sbjct: 290 IWSVPNAS 297


>sp|Q5ZMA2|PRP19_CHICK Pre-mRNA-processing factor 19 OS=Gallus
gallus GN=PRPF19 PE=1 SV=1
Length = 505

Score = 47.0 bits (110), Expect(2) = 1e-08
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = +1

Query: 70 DANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPL 249
D N ++ FD SG YLA+ G+DV+IY + + W ++L +G T V FG
Sbjct: 434 DNNFEVKSLIFDQSGTYLALGGTDVQIY----ICKQWT--EILHFTEHSGLTTGVAFGHH 487

Query: 250 AKYVATGTGDRTLRIFGV 303
AK++A+ DR+L+ + +
Sbjct: 488 AKFIASTGMDRSLKFYSL 505



Score = 30.8 bits (68), Expect(2) = 1e-08
Identities = 12/14 (85%), Positives = 14/14 (100%)
Frame = +3

Query: 15 VKLWDLRKLKNFRS 56
VKLWDLRKLKNF++
Sbjct: 417 VKLWDLRKLKNFKT 430



Score = 31.6 bits (70), Expect = 2.5
Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Frame = +1

Query: 175 DWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTGDRTLRIFGVPVAS 315
D ++ ++L L G + KVTSV F P V + + D T+RI+ VP AS
Sbjct: 251 DKSSEQILATLKGHSKKVTSVVFHPSQDLVFSASPDATIRIWSVPNAS 298


>sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus
GN=PRPF19 PE=2 SV=1
Length = 504

Score = 47.0 bits (110), Expect(2) = 1e-08
Identities = 27/78 (34%), Positives = 44/78 (56%)
Frame = +1

Query: 70 DANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTGKVTSVRFGPL 249
D N ++ FD SG YLA+ G+DV+IY + + W ++L +G T V FG
Sbjct: 433 DNNFEVKSLIFDQSGTYLALGGTDVQIY----ICKQWT--EILHFTEHSGLTTGVAFGHH 486

Query: 250 AKYVATGTGDRTLRIFGV 303
AK++A+ DR+L+ + +
Sbjct: 487 AKFIASTGMDRSLKFYSL 504



Score = 30.8 bits (68), Expect(2) = 1e-08
Identities = 12/14 (85%), Positives = 14/14 (100%)
Frame = +3

Query: 15 VKLWDLRKLKNFRS 56
VKLWDLRKLKNF++
Sbjct: 416 VKLWDLRKLKNFKT 429



Score = 34.3 bits (77), Expect = 0.38
Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
Frame = +1

Query: 115 NYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTGDRTLR 291
N + G+D + V D ++ ++L L G T KVTSV F P + V + + D T+R
Sbjct: 235 NKILTGGADKNV-----VVFDKSSEQILATLKGHTKKVTSVVFHPSQELVFSASPDATIR 289

Query: 292 IFGVPVAS 315
I+ VP AS
Sbjct: 290 IWSVPNAS 297


>sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae
GN=HIR1 PE=1 SV=2
Length = 840

Score = 41.6 bits (96), Expect = 0.002
Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 16/112 (14%)
Frame = +1

Query: 94 VEFDFSGNYLAIAGSD--VRIYQVSGVKQDWNTIKVLPDLS--------------GTGKV 225
V+ G LA G D +RI+ + + + + P++ TG +
Sbjct: 23 VDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSI 82

Query: 226 TSVRFGPLAKYVATGTGDRTLRIFGVPVASLEA*SIGEQWHFDLWT*PKRCV 381
T V+F P KY+A+G+ DR L I+ + + G + + WT KR V
Sbjct: 83 TCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLV 134


>sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans GN=hir1
PE=3 SV=1
Length = 985

Score = 40.4 bits (93), Expect = 0.005
Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
Frame = +1

Query: 70 DANTPTNAVEFDFS--GNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLS-GTGKVTSVRF 240
DAN P++A F +S + L G D ++ SG +T + L LS V + F
Sbjct: 119 DANPPSHAASFGWSCDSSILVSVGLDSKVVVWSG-----HTFEKLKTLSVHQSHVKGITF 173

Query: 241 GPLAKYVATGTGDRTLRIF 297
P KY AT + DRT+RIF
Sbjct: 174 DPANKYFATASDDRTVRIF 192



Score = 34.7 bits (78), Expect = 0.29
Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 5/67 (7%)
Frame = +1

Query: 112 GNYLAIAGSD--VRIYQVSGV--KQDWNTIKVLPDLSG-TGKVTSVRFGPLAKYVATGTG 276
G+ L A D VRI+ + +D N K L +S +G + +VRF P KY+A+G
Sbjct: 50 GSRLVTAAGDGYVRIWSTEAICGAEDANKPKQLASMSNHSGTIHTVRFSPNGKYLASGAD 109

Query: 277 DRTLRIF 297
D+ + I+
Sbjct: 110 DKIVCIY 116


tr_hit_id A9RKG4
Definition tr|A9RKG4|A9RKG4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 95
Score (bit) 137.0
E-value 5.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915646|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_A10.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RKG4|A9RKG4_PHYPA Predicted protein OS=Physcomitrella paten... 137 5e-39
tr|A9SC45|A9SC45_PHYPA Predicted protein OS=Physcomitrella paten... 139 7e-39
tr|B6TRQ7|B6TRQ7_MAIZE Pre-mRNA-splicing factor 19 OS=Zea mays P... 132 2e-36
tr|B4FAF0|B4FAF0_MAIZE Putative uncharacterized protein OS=Zea m... 130 5e-36
tr|A7NXH9|A7NXH9_VITVI Chromosome chr5 scaffold_2, whole genome ... 127 1e-34
tr|A5BPJ9|A5BPJ9_VITVI Putative uncharacterized protein OS=Vitis... 125 4e-34
tr|B8BHD2|B8BHD2_ORYSI Putative uncharacterized protein OS=Oryza... 125 2e-33
tr|Q9AV81|Q9AV81_ORYSJ Os10g0466300 protein OS=Oryza sativa subs... 123 7e-33
tr|A3C5K4|A3C5K4_ORYSJ Putative uncharacterized protein OS=Oryza... 123 7e-33
tr|Q2V4Q9|Q2V4Q9_ARATH Uncharacterized protein At1g04510.2 OS=Ar... 103 2e-26
tr|A6N0H6|A6N0H6_ORYSI Pre-mRNA-splicing factor 19 (Fragment) OS... 108 1e-22
tr|Q3EBP5|Q3EBP5_ARATH Uncharacterized protein At2g33340.2 OS=Ar... 89 3e-22
tr|Q56Z39|Q56Z39_ARATH Putative pre-mRNA splicing factor PRP19 (... 103 5e-21
tr|Q2V435|Q2V435_ARATH Uncharacterized protein At2g33340.3 OS=Ar... 70 2e-16
tr|Q16EG4|Q16EG4_AEDAE Wd-repeat protein OS=Aedes aegypti GN=AAE... 60 3e-11
tr|B0WVX1|B0WVX1_CULQU Cell cycle control protein cwf8 OS=Culex ... 59 6e-11
tr|Q7PTA2|Q7PTA2_ANOGA AGAP007217-PA OS=Anopheles gambiae GN=AGA... 59 7e-11
tr|B6M359|B6M359_BRAFL Putative uncharacterized protein OS=Branc... 57 9e-11
tr|Q7KLW9|Q7KLW9_DROME GTP-binding-protein OS=Drosophila melanog... 59 9e-11
tr|B4P4D8|B4P4D8_DROYA GE13910 OS=Drosophila yakuba GN=GE13910 P... 59 9e-11
tr|B4J4P2|B4J4P2_DROGR GH22157 OS=Drosophila grimshawi GN=GH2215... 59 9e-11
tr|B4HNP7|B4HNP7_DROSE GM19905 OS=Drosophila sechellia GN=GM1990... 59 9e-11
tr|B3NMT4|B3NMT4_DROER GG20970 OS=Drosophila erecta GN=GG20970 P... 59 9e-11
tr|B4LNJ0|B4LNJ0_DROVI GJ22447 OS=Drosophila virilis GN=GJ22447 ... 58 1e-10
tr|B4KM96|B4KM96_DROMO GI19385 OS=Drosophila mojavensis GN=GI193... 58 2e-10
tr|B3MDG5|B3MDG5_DROAN GF12947 OS=Drosophila ananassae GN=GF1294... 58 2e-10
tr|Q28YR7|Q28YR7_DROPS GA18945 OS=Drosophila pseudoobscura pseud... 57 3e-10
tr|B4NMY2|B4NMY2_DROWI GK23226 OS=Drosophila willistoni GN=GK232... 57 3e-10
tr|B4GIY7|B4GIY7_DROPE GL16701 OS=Drosophila persimilis GN=GL167... 57 3e-10
tr|A8I9S6|A8I9S6_CHLRE Spliceosome component, nuclear pre-mRNA s... 55 3e-10

>tr|A9RKG4|A9RKG4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_203375 PE=4 SV=1
Length = 522

Score = 137 bits (346), Expect(2) = 5e-39
Identities = 65/95 (68%), Positives = 77/95 (81%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
LK F F YD+NT TN VEFD+SG+YLA+ GSD+R+YQV+ VKQ+WNTIKV PDLSGTG
Sbjct: 428 LKNFRSFAPYDSNTLTNTVEFDYSGSYLAVGGSDIRLYQVASVKQEWNTIKVFPDLSGTG 487

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVPVASLEA 324
KVTSVRFGP A Y+A G+ DR LRIFG P A+ E+
Sbjct: 488 KVTSVRFGPDASYLAVGSSDRNLRIFGAPTATSES 522



Score = 46.6 bits (109), Expect(2) = 5e-39
Identities = 20/21 (95%), Positives = 21/21 (100%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
AQDGVKLWDLRKLKNFRSF+P
Sbjct: 416 AQDGVKLWDLRKLKNFRSFAP 436


>tr|A9SC45|A9SC45_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_183278 PE=4 SV=1
Length = 522

Score = 139 bits (349), Expect(2) = 7e-39
Identities = 64/94 (68%), Positives = 76/94 (80%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
LK F F YD NTPTN VEFD+SG+YLA+ GSD+R+YQV+ VKQ+WNTIK+ PDLSGTG
Sbjct: 428 LKNFRSFAPYDNNTPTNTVEFDYSGSYLAVGGSDIRVYQVASVKQEWNTIKIFPDLSGTG 487

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVPVASLE 321
KVTS+RFGP A Y+A G+ DR LRIFG P A+ E
Sbjct: 488 KVTSIRFGPDASYLAVGSSDRNLRIFGAPEAASE 521



Score = 45.1 bits (105), Expect(2) = 7e-39
Identities = 19/20 (95%), Positives = 20/20 (100%)
Frame = +3

Query: 6 QDGVKLWDLRKLKNFRSFSP 65
QDGVKLWDLRKLKNFRSF+P
Sbjct: 417 QDGVKLWDLRKLKNFRSFAP 436


>tr|B6TRQ7|B6TRQ7_MAIZE Pre-mRNA-splicing factor 19 OS=Zea mays PE=2
SV=1
Length = 526

Score = 132 bits (332), Expect(2) = 2e-36
Identities = 62/89 (69%), Positives = 73/89 (82%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F F YD++TPTN VEFDFSGNYLAI GSD+R+YQV+ VK +WN IK LPDLSGTG
Sbjct: 425 LRNFRTFSPYDSDTPTNTVEFDFSGNYLAIGGSDIRVYQVANVKAEWNLIKTLPDLSGTG 484

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
KVTSV+FG AKY+A G+ DR LRIFG+P
Sbjct: 485 KVTSVKFGADAKYIAVGSMDRNLRIFGLP 513



Score = 43.5 bits (101), Expect(2) = 2e-36
Identities = 18/21 (85%), Positives = 20/21 (95%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+FSP
Sbjct: 413 AHDGVKLWDLRKLRNFRTFSP 433


>tr|B4FAF0|B4FAF0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 526

Score = 130 bits (328), Expect(2) = 5e-36
Identities = 62/89 (69%), Positives = 72/89 (80%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F F YD +TPTN VEFDFSGNYLAI GSD+R+YQV+ VK +WN IK LPDLSGTG
Sbjct: 425 LRNFRTFSPYDLDTPTNTVEFDFSGNYLAIGGSDIRVYQVANVKAEWNLIKTLPDLSGTG 484

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
KVTSV+FG AKY+A G+ DR LRIFG+P
Sbjct: 485 KVTSVKFGVDAKYIAIGSMDRNLRIFGLP 513



Score = 43.5 bits (101), Expect(2) = 5e-36
Identities = 18/21 (85%), Positives = 20/21 (95%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+FSP
Sbjct: 413 AHDGVKLWDLRKLRNFRTFSP 433


>tr|A7NXH9|A7NXH9_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020342001
PE=4 SV=1
Length = 453

Score = 127 bits (320), Expect(2) = 1e-34
Identities = 60/89 (67%), Positives = 71/89 (79%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F F YD+NT TN+VEFD SGNYLAIAGSD+R+YQV+ VK +WN IK PDLSGTG
Sbjct: 357 LRNFRTFTPYDSNTATNSVEFDHSGNYLAIAGSDIRVYQVANVKSEWNCIKTFPDLSGTG 416

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
K T V+FGP AKY+A G+ DR LRIFG+P
Sbjct: 417 KATCVKFGPDAKYLAVGSMDRNLRIFGLP 445



Score = 42.4 bits (98), Expect(2) = 1e-34
Identities = 17/21 (80%), Positives = 20/21 (95%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+F+P
Sbjct: 345 AHDGVKLWDLRKLRNFRTFTP 365


>tr|A5BPJ9|A5BPJ9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037044 PE=4 SV=1
Length = 247

Score = 125 bits (315), Expect(2) = 4e-34
Identities = 59/89 (66%), Positives = 71/89 (79%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F F YD+NT TN+VEFD SG+YLAIAGSD+R+YQV+ VK +WN IK PDLSGTG
Sbjct: 151 LRNFRTFTPYDSNTATNSVEFDHSGSYLAIAGSDIRVYQVANVKSEWNCIKTFPDLSGTG 210

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
K T V+FGP AKY+A G+ DR LRIFG+P
Sbjct: 211 KATCVKFGPDAKYLAVGSMDRNLRIFGLP 239



Score = 42.4 bits (98), Expect(2) = 4e-34
Identities = 17/21 (80%), Positives = 20/21 (95%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+F+P
Sbjct: 139 AHDGVKLWDLRKLRNFRTFTP 159


>tr|B8BHD2|B8BHD2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_33953 PE=4 SV=1
Length = 502

Score = 125 bits (313), Expect(2) = 2e-33
Identities = 57/89 (64%), Positives = 72/89 (80%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F YD++TPTN+VEFDFSG+YLA+ GSD R+YQV+ VK +WN +K LPDLSGTG
Sbjct: 400 LRNFRTISPYDSDTPTNSVEFDFSGSYLAVGGSDTRVYQVANVKLEWNLVKTLPDLSGTG 459

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
KVT+V+FG AKY+A G+ DR LRIFG+P
Sbjct: 460 KVTNVKFGTDAKYIAVGSMDRNLRIFGLP 488



Score = 40.4 bits (93), Expect(2) = 2e-33
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+ SP
Sbjct: 388 ALDGVKLWDLRKLRNFRTISP 408


>tr|Q9AV81|Q9AV81_ORYSJ Os10g0466300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0006L06.5 PE=2 SV=1
Length = 527

Score = 123 bits (309), Expect(2) = 7e-33
Identities = 57/89 (64%), Positives = 71/89 (79%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F YD++TPTN+VEFDFSG+YLA+ GSD R+YQV+ VK +WN +K LPDLSGTG
Sbjct: 425 LRNFRTISPYDSDTPTNSVEFDFSGSYLAVGGSDTRVYQVANVKLEWNLVKTLPDLSGTG 484

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
KVT+V+FG AKY+A G+ DR LRIFG P
Sbjct: 485 KVTNVKFGTDAKYIAVGSMDRNLRIFGHP 513



Score = 40.4 bits (93), Expect(2) = 7e-33
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+ SP
Sbjct: 413 ALDGVKLWDLRKLRNFRTISP 433


>tr|A3C5K4|A3C5K4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030576 PE=4 SV=1
Length = 497

Score = 123 bits (309), Expect(2) = 7e-33
Identities = 57/89 (64%), Positives = 71/89 (79%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
L+ F YD++TPTN+VEFDFSG+YLA+ GSD R+YQV+ VK +WN +K LPDLSGTG
Sbjct: 395 LRNFRTISPYDSDTPTNSVEFDFSGSYLAVGGSDTRVYQVANVKLEWNLVKTLPDLSGTG 454

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
KVT+V+FG AKY+A G+ DR LRIFG P
Sbjct: 455 KVTNVKFGTDAKYIAVGSMDRNLRIFGHP 483



Score = 40.4 bits (93), Expect(2) = 7e-33
Identities = 17/21 (80%), Positives = 19/21 (90%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSFSP 65
A DGVKLWDLRKL+NFR+ SP
Sbjct: 383 ALDGVKLWDLRKLRNFRTISP 403


>tr|Q2V4Q9|Q2V4Q9_ARATH Uncharacterized protein At1g04510.2
OS=Arabidopsis thaliana GN=At1g04510 PE=4 SV=1
Length = 523

Score = 103 bits (258), Expect(2) = 2e-26
Identities = 53/89 (59%), Positives = 65/89 (73%)
Frame = +1

Query: 40 LKIFGPFHRYDANTPTNAVEFDFSGNYLAIAGSDVRIYQVSGVKQDWNTIKVLPDLSGTG 219
LK F F DAN+ VEFD SG+YL IA SD+R++Q + VK +WN IK LPDLSGTG
Sbjct: 427 LKNFRTFDFPDANS----VEFDHSGSYLGIAASDIRVFQAASVKAEWNPIKTLPDLSGTG 482

Query: 220 KVTSVRFGPLAKYVATGTGDRTLRIFGVP 306
K TSV+FG +KY+A G+ DR LRIFG+P
Sbjct: 483 KSTSVKFGLDSKYIAVGSMDRNLRIFGLP 511



Score = 38.5 bits (88), Expect(2) = 2e-26
Identities = 16/19 (84%), Positives = 18/19 (94%)
Frame = +3

Query: 3 AQDGVKLWDLRKLKNFRSF 59
A DGV+LWDLRKLKNFR+F
Sbjct: 415 ALDGVRLWDLRKLKNFRTF 433