BP915653
Clone id YMU001_000074_B06
Library
Length 422
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_B06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGAGATATAATGAATAACCCTGAATATCATAATACACAATGGTGTGTGCTGATGAGCTG
TTAGAATTTCCTTAGACAATAATGGTACAAATTTGGCGAAATCCTTGACACACAATACAG
TTATGCCCTGTATAGCCACTCACATTGACCTTCTACTGTATTGCTGCTGTAGATAAGCAT
TTGCCTACCATCATGGTCAGACTTCGGTGGGAAAAAAATGATTTACATAGATGGTCAGCA
CTCGTGCAGGCAGAAAATCTGGCAACTACGTCAAGCAAAATAACCAGATTCCCGACTACC
AGCTGGGCCAAGAAAAGTGGGAGACCCTACTTGAGCAGGCATTGCAACATAAGACTGATG
ATTATGAGAAAAGCGCTGCGAAAAAACTTCTCCCGTCCTGTGAAACACATGATCTGATCT
TC
■■Homology search results ■■ -
sp_hit_id Q9RMV4
Definition sp|Q9RMV4|Y6611_BACAN Uncharacterized protein pXO2-81/BXB0111/GBAA_pXO2_0111 OS=Bacillus anthracis
Align length 80
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915653|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_B06.
(422 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9RMV4|Y6611_BACAN Uncharacterized protein pXO2-81/BXB0111/GB... 32 1.3
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorh... 31 2.3
sp|Q6T264|MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus ... 30 5.0
sp|A6W961|T23O_KINRD Tryptophan 2,3-dioxygenase OS=Kineococcus r... 29 8.6
sp|Q6D0B9|NHAA_ERWCT Na(+)/H(+) antiporter nhaA OS=Erwinia carot... 29 8.6
sp|A6QP75|AL2CL_BOVIN ALS2 C-terminal-like protein OS=Bos taurus... 29 8.6

>sp|Q9RMV4|Y6611_BACAN Uncharacterized protein
pXO2-81/BXB0111/GBAA_pXO2_0111 OS=Bacillus anthracis
GN=pXO2-81 PE=4 SV=1
Length = 589

Score = 31.6 bits (70), Expect = 1.3
Identities = 20/80 (25%), Positives = 35/80 (43%)
Frame = +1

Query: 157 CIAAVDKHLPTIMVRLRWEKNDLHRWSALVQAENLATTSSKITRFPTTSWAKKSGRPYLS 336
CIA + +MV ++W + DL + A+ E A S +I S + Y+
Sbjct: 401 CIALEHNEIKKLMVVIQWSEADLEKNKAIPFGEANAIMSKRIAEIDAESKRAEEKGEYVP 460

Query: 337 RHCNIRLMIMRKALRKNFSR 396
+I+ K + K+F+R
Sbjct: 461 YEKTRYHLILPKEMDKDFNR 480


>sp|P34528|YM67_CAEEL Putative serine protease K12H4.7
OS=Caenorhabditis elegans GN=K12H4.7 PE=1 SV=2
Length = 510

Score = 30.8 bits (68), Expect = 2.3
Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
Frame = -3

Query: 414 DHVFHRTGEVFSQRFSHNHQSYVAMPAQVGSPTFLGPAG-SRESGYF 277
DH G+ F QR+ HN+Q Y A G P FL G ES Y+
Sbjct: 68 DHFDSSVGKTFQQRYYHNNQWYKA-----GGPAFLMLGGEGPESSYW 109


>sp|Q6T264|MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus
GN=Maml1 PE=1 SV=2
Length = 1020

Score = 29.6 bits (65), Expect = 5.0
Identities = 11/35 (31%), Positives = 22/35 (62%)
Frame = +3

Query: 258 SGNYVKQNNQIPDYQLGQEKWETLLEQALQHKTDD 362
+G V Q+N +PD L +++W+ L+E+ + D+
Sbjct: 238 AGGSVAQSNLMPDLNLNEQEWKELIEELNRSVPDE 272


>sp|A6W961|T23O_KINRD Tryptophan 2,3-dioxygenase OS=Kineococcus
radiotolerans (strain ATCC BAA-149 / DSM 14245 /
SRS30216) GN=kynA PE=3 SV=1
Length = 286

Score = 28.9 bits (63), Expect = 8.6
Identities = 11/24 (45%), Positives = 16/24 (66%)
Frame = -2

Query: 82 LLSKEILTAHQHTPLCIMIFRVIH 11
LL +++ AH HTP + FRVI+
Sbjct: 189 LLERDVTKAHVHTPALVATFRVIY 212


>sp|Q6D0B9|NHAA_ERWCT Na(+)/H(+) antiporter nhaA OS=Erwinia
carotovora subsp. atroseptica GN=nhaA PE=3 SV=1
Length = 393

Score = 28.9 bits (63), Expect = 8.6
Identities = 16/49 (32%), Positives = 27/49 (55%)
Frame = -1

Query: 377 SAFLIIISLMLQCLLK*GLPLFLAQLVVGNLVILLDVVARFSACTSADH 231
SA+L++ ++ C+LK G+ LA ++VG + L S TS +H
Sbjct: 207 SAYLLVGGVLWVCILKCGVHATLAGVIVGFFIPLRTSDGEPSPATSLEH 255


>sp|A6QP75|AL2CL_BOVIN ALS2 C-terminal-like protein OS=Bos taurus
GN=ALS2CL PE=2 SV=1
Length = 953

Score = 28.9 bits (63), Expect = 8.6
Identities = 18/52 (34%), Positives = 27/52 (51%)
Frame = +3

Query: 237 STRAGRKSGNYVKQNNQIPDYQLGQEKWETLLEQALQHKTDDYEKSAAKKLL 392
S+R RKS Y+ P+ Q G + E LLE+ LQH+ + + +K L
Sbjct: 629 SSRELRKSQEYLCCERTCPEDQAG--RMEDLLEELLQHREPEALQQCLRKAL 678


tr_hit_id B6PGC5
Definition tr|B6PGC5|B6PGC5_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae
Align length 63
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915653|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_B06.
(422 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6PGC5|B6PGC5_BRAFL Putative uncharacterized protein (Fragmen... 35 1.4
tr|B0C7I0|B0C7I0_ACAM1 Universal stress protein OS=Acaryochloris... 35 1.8
tr|Q2NWP5|Q2NWP5_SODGM Putative uncharacterized protein OS=Sodal... 33 5.4
tr|A6Q682|A6Q682_SULNB Type II secretion system protein D OS=Sul... 33 5.4
tr|B0TRN4|B0TRN4_SHEHH Radical SAM domain protein OS=Shewanella ... 33 7.0
tr|Q9Z636|Q9Z636_STRPN UDP-N-acetylglucosamine 2-epimerase OS=St... 33 7.0
tr|B0W357|B0W357_CULQU Translational activator gcn1 OS=Culex qui... 33 9.2

>tr|B6PGC5|B6PGC5_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_249620 PE=4 SV=1
Length = 1715

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 11/63 (17%)
Frame = -1

Query: 383 FRSAFLII--------ISLMLQCLLK*G---LPLFLAQLVVGNLVILLDVVARFSACTSA 237
F +FLII I M C+L G +PLF+ +++GNLVIL +A +C SA
Sbjct: 730 FLHSFLIIFRVLCGEWIENMWVCMLVNGWACIPLFILSMIIGNLVILNLFLALLLSCFSA 789

Query: 236 DHL 228
D L
Sbjct: 790 DSL 792


>tr|B0C7I0|B0C7I0_ACAM1 Universal stress protein OS=Acaryochloris
marina (strain MBIC 11017) GN=AM1_6334 PE=4 SV=1
Length = 167

Score = 35.0 bits (79), Expect = 1.8
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = +3

Query: 255 KSGNYVKQNNQIPDYQLGQEKWETLLEQALQHKTDDYEKSAAKKLLPSCET 407
K NY + D Q Q+KWET +EQA + Y+++ + +L +CE+
Sbjct: 59 KGANYFTPYDDA-DLQFAQQKWETQIEQANEWLLQYYQQATQRGVLATCES 108


>tr|Q2NWP5|Q2NWP5_SODGM Putative uncharacterized protein OS=Sodalis
glossinidius (strain morsitans) GN=SG0155 PE=4 SV=1
Length = 648

Score = 33.5 bits (75), Expect = 5.4
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
Frame = +3

Query: 183 AYHHGQTSVGKK*FT*MVSTRAGRKSGN-YVKQNNQIPDYQLGQEKWETLLEQAL 344
AY GQT+V + AG + GN + +N++P G KW TLLE L
Sbjct: 353 AYRPGQTAVEVMESAEHAAREAGLQGGNGWSVYDNRVPQQARGNVKWRTLLENTL 407


>tr|A6Q682|A6Q682_SULNB Type II secretion system protein D
OS=Sulfurovum sp. (strain NBC37-1) GN=SUN_0030 PE=3 SV=1
Length = 678

Score = 33.5 bits (75), Expect = 5.4
Identities = 17/51 (33%), Positives = 27/51 (52%)
Frame = +3

Query: 252 RKSGNYVKQNNQIPDYQLGQEKWETLLEQALQHKTDDYEKSAAKKLLPSCE 404
RKSG+ K + + + Q ++ L+EQAL+ + S AK L+P E
Sbjct: 600 RKSGDLQKLKEMLAELEEVQVRYNRLVEQALEKNKGKHHSSPAKALVPKTE 650


>tr|B0TRN4|B0TRN4_SHEHH Radical SAM domain protein OS=Shewanella
halifaxensis (strain HAW-EB4) GN=Shal_1887 PE=4 SV=1
Length = 414

Score = 33.1 bits (74), Expect = 7.0
Identities = 15/44 (34%), Positives = 22/44 (50%)
Frame = +3

Query: 291 PDYQLGQEKWETLLEQALQHKTDDYEKSAAKKLLPSCETHDLIF 422
PDY+LG L E A K +D+ + + L P C+ D +F
Sbjct: 308 PDYKLGNINDHQLDEMAFSKKQEDFGRGKSTTLTPQCQRCDYLF 351


>tr|Q9Z636|Q9Z636_STRPN UDP-N-acetylglucosamine 2-epimerase
OS=Streptococcus pneumoniae GN=cps19CK PE=3 SV=1
Length = 361

Score = 33.1 bits (74), Expect = 7.0
Identities = 17/53 (32%), Positives = 27/53 (50%)
Frame = +1

Query: 253 ENLATTSSKITRFPTTSWAKKSGRPYLSRHCNIRLMIMRKALRKNFSRPVKHM 411
EN+ T + + TT+ K P L + N RL+++ R+N P+KHM
Sbjct: 162 ENVYVTGNTVIDALTTTVQKDYTHPDLDLNVNTRLILLTAHRRENLGEPMKHM 214


>tr|B0W357|B0W357_CULQU Translational activator gcn1 OS=Culex
quinquefasciatus GN=CpipJ_CPIJ001363 PE=4 SV=1
Length = 2651

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/57 (26%), Positives = 33/57 (57%)
Frame = -3

Query: 183 QMLIYSSNTVEGQCEWLYRA*LYCVSRISPNLYHYCLRKF*QLISTHHCVL*YSGLF 13
++L+ + V+G+ E LY+A +YCV+ + YCL + +++++ + + LF
Sbjct: 542 KLLLNHLDNVKGEVEALYKAVVYCVNSHHKKVRKYCLPRLERIVNSSNGITLAKSLF 598