BP915668
Clone id YMU001_000074_C11
Library
Length 240
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAAGCTTATCGGGACACCTACGTTCCAGACACTATGGTACAGTTTGCAGCACCCGACTC
TCTCTTTCTCTATAGGAATCCTAACTCTATTTAAGACGCACACGCAACAAGAGCTCAAAA
CATACTGTTTCGCACCTTAGGTTCCCCGCACTGGCCCACCACCGCCAATGGGGCGACCAG
CGCCACCACCTTGCATTGCTTGCATTTGATATTGTGCTTGCACATATTGATGTTGGGGAT
■■Homology search results ■■ -
sp_hit_id Q6AST1
Definition sp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. japonica
Align length 54
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915668|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_C11.
(240 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX32 OS=O... 29 6.4
sp|A2XK30|HOX32_ORYSI Homeobox-leucine zipper protein HOX32 OS=O... 29 6.4

>sp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX32
OS=Oryza sativa subsp. japonica GN=HOX32 PE=2 SV=1
Length = 859

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/54 (29%), Positives = 24/54 (44%)
Frame = +2

Query: 8 YRDTYVPDTMVQFAAPDSLFLYRNPNSI*DAHATRAQNILFRTLGSPHWPTTAN 169
Y TY P T+ AAP ++ R + + D + L ++ G P P T N
Sbjct: 275 YMQTYAPTTL---AAPRDFWILRYTSGLEDGSLVICERSLTQSTGGPSGPNTPN 325


>sp|A2XK30|HOX32_ORYSI Homeobox-leucine zipper protein HOX32
OS=Oryza sativa subsp. indica GN=HOX32 PE=2 SV=1
Length = 859

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/54 (29%), Positives = 24/54 (44%)
Frame = +2

Query: 8 YRDTYVPDTMVQFAAPDSLFLYRNPNSI*DAHATRAQNILFRTLGSPHWPTTAN 169
Y TY P T+ AAP ++ R + + D + L ++ G P P T N
Sbjct: 275 YMQTYAPTTL---AAPRDFWILRYTSGLEDGSLVICERSLTQSTGGPSGPNTPN 325


tr_hit_id B5WA55
Definition tr|B5WA55|B5WA55_SPIMA Extracellular solute-binding protein family 1 OS=Arthrospira maxima CS-328
Align length 63
Score (bit) 32.7
E-value 9.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915668|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_C11.
(240 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5WA55|B5WA55_SPIMA Extracellular solute-binding protein fami... 33 9.2

>tr|B5WA55|B5WA55_SPIMA Extracellular solute-binding protein family
1 OS=Arthrospira maxima CS-328 GN=AmaxDRAFT_5655 PE=3
SV=1
Length = 460

Score = 32.7 bits (73), Expect = 9.2
Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 8/63 (12%)
Frame = +2

Query: 8 YRDTYVPDTMVQFAAPDSLFLYRNPNSI*DAHAT--------RAQNILFRTLGSPHWPTT 163
Y+D YVP + + +A PD+ + + NSI A+ + + F+ L + WP T
Sbjct: 265 YKDGYVPPSAIDWANPDNNVSFLSRNSILTANPSLSIPGSQRQDTQTYFQDLVTIDWPNT 324

Query: 164 ANG 172
NG
Sbjct: 325 LNG 327