BP915682
Clone id YMU001_000074_E10
Library
Length 336
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTAAGTGTAACACCACCACCAACTTACTAGTTGCACATGGATACAACAAAGAGAGAC
CATCCATTGTTCCCATGCATACTTGCACACATGGCAACGTCCTGAAAATTTTATATTGCG
CACCTCATTGATTAAGCTCAGTCGACTGACTAACAAAATACAATCAAGAAGTTATCTAGA
GAGAGGCCCTTCCTGGTACAACACAATCCCTAGAATTGTGACCAGGCAAACTGCCCTTAC
CTGAGAAAATTACTGGAGCGCTATGTGACAATGTAATTGTGAACTGTCGCTATTTTGAGC
TGCATTTGAACTACCCAGTTTGACGCTGCGAGACTT
■■Homology search results ■■ -
sp_hit_id Q5U465
Definition sp|Q5U465|CC125_MOUSE Coiled-coil domain-containing protein 125 OS=Mus musculus
Align length 48
Score (bit) 33.1
E-value 0.44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915682|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_E10.
(336 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5U465|CC125_MOUSE Coiled-coil domain-containing protein 125 ... 33 0.44
sp|Q4KM91|CDCA7_RAT Cell division cycle-associated protein 7 OS=... 31 1.7
sp|Q5FS11|MNME_GLUOX tRNA modification GTPase mnmE OS=Gluconobac... 31 2.2
sp|Q86Z20|CC125_HUMAN Coiled-coil domain-containing protein 125 ... 31 2.2
sp|Q9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7 O... 30 2.9

>sp|Q5U465|CC125_MOUSE Coiled-coil domain-containing protein 125
OS=Mus musculus GN=Ccdc125 PE=2 SV=1
Length = 500

Score = 33.1 bits (74), Expect = 0.44
Identities = 17/48 (35%), Positives = 28/48 (58%)
Frame = +2

Query: 38 TWIQQRETIHCSHAYLHTWQRPENFILRTSLIKLSRLTNKIQSRSYLE 181
+WIQ+ + ++C +A L EN LRT IK+ + N + ++ YLE
Sbjct: 193 SWIQKCDRLNCDNAVLR-----ENLKLRTEEIKMLKSKNAVLNQRYLE 235


>sp|Q4KM91|CDCA7_RAT Cell division cycle-associated protein 7
OS=Rattus norvegicus GN=Cdca7 PE=2 SV=1
Length = 377

Score = 31.2 bits (69), Expect = 1.7
Identities = 14/25 (56%), Positives = 17/25 (68%)
Frame = -3

Query: 262 SAPVIFSGKGSLPGHNSRDCVVPGR 188
S P IFSG+ SLPGH ++D P R
Sbjct: 140 SFPGIFSGRHSLPGHRTKDSKSPRR 164


>sp|Q5FS11|MNME_GLUOX tRNA modification GTPase mnmE OS=Gluconobacter
oxydans GN=mnmE PE=3 SV=1
Length = 437

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/44 (34%), Positives = 20/44 (45%)
Frame = +2

Query: 50 QRETIHCSHAYLHTWQRPENFILRTSLIKLSRLTNKIQSRSYLE 181
Q H HA TW LR S++ L RLT ++ S L+
Sbjct: 384 QEAVTHLDHARTATWPELRGEELRLSMLALGRLTGRVDVESLLD 427


>sp|Q86Z20|CC125_HUMAN Coiled-coil domain-containing protein 125
OS=Homo sapiens GN=CCDC125 PE=2 SV=2
Length = 511

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/48 (31%), Positives = 28/48 (58%)
Frame = +2

Query: 38 TWIQQRETIHCSHAYLHTWQRPENFILRTSLIKLSRLTNKIQSRSYLE 181
+WIQ+ + ++C +A L EN ++T IK+ + N + ++ YLE
Sbjct: 199 SWIQKYDRLNCENAVL-----KENLKVKTEEIKMLKSDNAVLNQRYLE 241


>sp|Q9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7
OS=Mus musculus GN=Cdca7 PE=1 SV=1
Length = 382

Score = 30.4 bits (67), Expect = 2.9
Identities = 13/25 (52%), Positives = 17/25 (68%)
Frame = -3

Query: 262 SAPVIFSGKGSLPGHNSRDCVVPGR 188
S P +FSG+ SLPGH ++D P R
Sbjct: 144 SFPGLFSGRHSLPGHRAKDSKSPRR 168


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915682|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_E10.
(336 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******