BP915696
Clone id YMU001_000074_G01
Library
Length 514
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTGCACTTCGAAGTCTTGACTCCAGGCATGCTGTTTAGTTCTGCGGTTCCAAGAGAAGC
ATTGGATGAAGGGCATTTTGTCATACCCAGATTGATCGAGCTTGGAACAGATGATCTGAT
CTGTCAAGGACAAGGCTTCATACAATGGCTCATGAAGAATGTGTCAGGGGAGAGATGGTC
TTCTTTATATCGATCTTGATGAGTGCACAAATGGGGTGCAGCATCTGTTCATGCGAAATG
AGGGAATATCCGGATTCAACAGCCTTCTGTTATAAAGTAGCCTTCTTTGATGATGCGGAG
ACTCCCAGAGCAATATGGGAGATGTGACCCCTGTGAAAGAGGTGGATCAAGCAGGATAGG
GTTAGCTGGTGCTTGAGAGTACAAAGCATGCAAGTAAGTTCCACAATACACAGGAACACA
TGGAGAAAGTCTATTAGATGTCACAACTTTAGCTTGAGGTCAATTTCACAATACTCGAAA
ACATGGAGTAAGACTATCAGTCGCAACTTTGTTT
■■Homology search results ■■ -
sp_hit_id Q9P2K9
Definition sp|Q9P2K9|PTHD2_HUMAN Patched domain-containing protein 2 OS=Homo sapiens
Align length 42
Score (bit) 32.0
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915696|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_G01.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9P2K9|PTHD2_HUMAN Patched domain-containing protein 2 OS=Hom... 32 1.7
sp|Q0SQ58|MURC_CLOPS UDP-N-acetylmuramate--L-alanine ligase OS=C... 32 1.8
sp|Q8XHJ0|MURC_CLOPE UDP-N-acetylmuramate--L-alanine ligase OS=C... 32 1.8
sp|Q0TMG0|MURC_CLOP1 UDP-N-acetylmuramate--L-alanine ligase OS=C... 32 1.8
sp|Q9BWP8|COL11_HUMAN Collectin-11 OS=Homo sapiens GN=COLEC11 PE... 32 2.2
sp|P49013|FBP3_STRPU Fibropellin-3 OS=Strongylocentrotus purpura... 32 2.3
sp|Q7T0T0|COL11_XENLA Collectin-11 OS=Xenopus laevis GN=colec11 ... 31 2.9
sp|A0PXK5|MURC_CLONN UDP-N-acetylmuramate--L-alanine ligase OS=C... 31 3.9
sp|Q9C0A1|ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sap... 30 6.5
sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP1... 30 6.5
sp|Q899J1|MURC_CLOTE UDP-N-acetylmuramate--L-alanine ligase OS=C... 30 6.7
sp|A5N4I2|MURC_CLOK5 UDP-N-acetylmuramate--L-alanine ligase OS=C... 30 8.7

>sp|Q9P2K9|PTHD2_HUMAN Patched domain-containing protein 2 OS=Homo
sapiens GN=PTCHD2 PE=2 SV=2
Length = 1392

Score = 32.0 bits (71), Expect = 1.7
Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
Frame = -3

Query: 329 GHISHIALGVSASSKKATL*-QKAVESGYSLISHEQMLHPIC 207
GH+ H+ ++A+S+ + + SGYS+ S QMLHP C
Sbjct: 1050 GHLCHLCKAIAANSELVKPGGAQCLPSGYSISSFLQMLHPEC 1091


>sp|Q0SQ58|MURC_CLOPS UDP-N-acetylmuramate--L-alanine ligase
OS=Clostridium perfringens (strain SM101 / Type A)
GN=murC PE=3 SV=1
Length = 457

Score = 32.0 bits (71), Expect = 1.8
Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 8/73 (10%)
Frame = -2

Query: 351 LDPPLSQGSHLPYCSGSLRIIKEGYFITEGC-----*IRIFPH---FA*TDAAPHLCTHQ 196
LDP + G L G+ R+ YFITE C +R FP+ DA H
Sbjct: 138 LDPTILVGGDLDIIHGNFRVGNSEYFITEACEYKQSFLRFFPYVGIILNIDA-----DHL 192

Query: 195 DRYKEDHLSPDTF 157
D YK+ + DTF
Sbjct: 193 DFYKDINHIKDTF 205


>sp|Q8XHJ0|MURC_CLOPE UDP-N-acetylmuramate--L-alanine ligase
OS=Clostridium perfringens GN=murC PE=3 SV=2
Length = 457

Score = 32.0 bits (71), Expect = 1.8
Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 8/73 (10%)
Frame = -2

Query: 351 LDPPLSQGSHLPYCSGSLRIIKEGYFITEGC-----*IRIFPH---FA*TDAAPHLCTHQ 196
LDP + G L G+ R+ YFITE C +R FP+ DA H
Sbjct: 138 LDPTILVGGDLDIIHGNFRVGNSEYFITEACEYKQSFLRFFPYVGIILNIDA-----DHL 192

Query: 195 DRYKEDHLSPDTF 157
D YK+ + DTF
Sbjct: 193 DFYKDINHIKDTF 205


>sp|Q0TMG0|MURC_CLOP1 UDP-N-acetylmuramate--L-alanine ligase
OS=Clostridium perfringens (strain ATCC 13124 / NCTC
8237 / Type A) GN=murC PE=3 SV=2
Length = 457

Score = 32.0 bits (71), Expect = 1.8
Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 8/73 (10%)
Frame = -2

Query: 351 LDPPLSQGSHLPYCSGSLRIIKEGYFITEGC-----*IRIFPH---FA*TDAAPHLCTHQ 196
LDP + G L G+ R+ YFITE C +R FP+ DA H
Sbjct: 138 LDPTILVGGDLDIIHGNFRVGNSEYFITEACEYKQSFLRFFPYVGIILNIDA-----DHL 192

Query: 195 DRYKEDHLSPDTF 157
D YK+ + DTF
Sbjct: 193 DFYKDINHIKDTF 205


>sp|Q9BWP8|COL11_HUMAN Collectin-11 OS=Homo sapiens GN=COLEC11 PE=2
SV=1
Length = 271

Score = 31.6 bits (70), Expect = 2.2
Identities = 14/43 (32%), Positives = 23/43 (53%)
Frame = +3

Query: 123 VKDKASYNGS*RMCQGRDGLLYIDLDECTNGVQHLFMRNEGIS 251
VK++ Y + CQGR G L + DE NG+ ++ G++
Sbjct: 157 VKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLA 199


>sp|P49013|FBP3_STRPU Fibropellin-3 OS=Strongylocentrotus purpuratus
GN=EGF3 PE=1 SV=1
Length = 570

Score = 31.6 bits (70), Expect = 2.3
Identities = 17/37 (45%), Positives = 20/37 (54%)
Frame = +2

Query: 329 PCERGGSSRIGLAGA*EYKACK*VPQYTGTHGESLLD 439
PC GGS G+ G C+ +P YTGTH E LD
Sbjct: 336 PCLNGGSCLDGVDGY----VCQCLPNYTGTHCEISLD 368


>sp|Q7T0T0|COL11_XENLA Collectin-11 OS=Xenopus laevis GN=colec11
PE=2 SV=1
Length = 271

Score = 31.2 bits (69), Expect = 2.9
Identities = 15/43 (34%), Positives = 24/43 (55%)
Frame = +3

Query: 123 VKDKASYNGS*RMCQGRDGLLYIDLDECTNGVQHLFMRNEGIS 251
VK++ Y + CQGR G L + DE TN + ++ + G+S
Sbjct: 157 VKEEKKYIDAQDYCQGRGGTLSMPKDEATNSLIASYINHAGLS 199


>sp|A0PXK5|MURC_CLONN UDP-N-acetylmuramate--L-alanine ligase
OS=Clostridium novyi (strain NT) GN=murC PE=3 SV=1
Length = 458

Score = 30.8 bits (68), Expect = 3.9
Identities = 12/31 (38%), Positives = 19/31 (61%)
Frame = -2

Query: 351 LDPPLSQGSHLPYCSGSLRIIKEGYFITEGC 259
LDP + G +L +G++R+ YF+TE C
Sbjct: 138 LDPTILVGGNLDVINGNVRVGNSEYFVTEAC 168


>sp|Q9C0A1|ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens
GN=ZFHX2 PE=2 SV=2
Length = 1427

Score = 30.0 bits (66), Expect = 6.5
Identities = 13/36 (36%), Positives = 19/36 (52%)
Frame = -3

Query: 392 CMLCTLKHQLTLSCLIHLFHRGHISHIALGVSASSK 285
C C +K+ +SC HLF R H++ + V A K
Sbjct: 1003 CPYCDVKYDFYVSCRGHLFSRQHLAKLKEAVRAQLK 1038


>sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12
PE=1 SV=2
Length = 1297

Score = 30.0 bits (66), Expect = 6.5
Identities = 22/77 (28%), Positives = 35/77 (45%)
Frame = -3

Query: 401 ELTCMLCTLKHQLTLSCLIHLFHRGHISHIALGVSASSKKATL*QKAVESGYSLISHEQM 222
E + TL H L +C + FH + H G+S S A L + + + Y + E
Sbjct: 328 ETLLRVMTLSHVLVTACAMQAFH--SLFHARPGLSTLS--AELNAQIITALYDYVPSEND 383

Query: 221 LHPICALIKIDIKKTIS 171
L P+ A +K+ K I+
Sbjct: 384 LQPLLAWLKVMEKAHIN 400


tr_hit_id Q240M8
Definition tr|Q240M8|Q240M8_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 57
Score (bit) 34.7
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915696|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_G01.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q240M8|Q240M8_TETTH Putative uncharacterized protein OS=Tetra... 35 2.9
tr|Q0K6C2|Q0K6C2_RALEH Cytosine deaminase or related metal-depen... 34 4.9
tr|Q46WP2|Q46WP2_RALEJ Amidohydrolase OS=Ralstonia eutropha (str... 33 6.4
tr|B3R761|B3R761_CUPTR HYDROXY-ATRAZINE ETHYL AMINO HYDROLASE PR... 33 6.4

>tr|Q240M8|Q240M8_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01117300 PE=4
SV=1
Length = 2884

Score = 34.7 bits (78), Expect = 2.9
Identities = 18/57 (31%), Positives = 30/57 (52%)
Frame = -2

Query: 207 CTHQDRYKEDHLSPDTFFMSHCMKPCP*QIRSSVPSSINLGMTKCPSSNASLGTAEL 37
CT Q R + +S F+ + C CP S+VP +I+ T CPS+ A+ + ++
Sbjct: 1216 CTDQSRNCQSCISTAGFYQNKCYSTCP----SNVPLNIDGQCTSCPSNCATCSSLDV 1268


>tr|Q0K6C2|Q0K6C2_RALEH Cytosine deaminase or related
metal-dependent hydrolase OS=Ralstonia eutropha (strain
ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A3380
PE=3 SV=1
Length = 468

Score = 33.9 bits (76), Expect = 4.9
Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 9/92 (9%)
Frame = -2

Query: 294 IIKEGYFITEGC*IRIFPHFA*TDAAPHLCTHQDRYK---------EDHLSPDTFFMSHC 142
+++E G +R+ H + TD C +++Y+ D L PD +F +H
Sbjct: 233 LLRELAAFGRGMDLRLHSHLSETDNYVKFC--REKYQCTPVQFVADHDWLGPDVWF-AHL 289

Query: 141 MKPCP*QIRSSVPSSINLGMTKCPSSNASLGT 46
+ P +IR + N GM CP SNA LG+
Sbjct: 290 VTVNPEEIRMLAVT--NTGMAHCPVSNARLGS 319


>tr|Q46WP2|Q46WP2_RALEJ Amidohydrolase OS=Ralstonia eutropha (strain
JMP134) GN=Reut_A3081 PE=4 SV=1
Length = 464

Score = 33.5 bits (75), Expect = 6.4
Identities = 32/118 (27%), Positives = 48/118 (40%), Gaps = 9/118 (7%)
Frame = -2

Query: 372 APANPILLDPPLSQGSHLPYCSGSLRIIKEGYFITEGC*IRIFPHFA*TDAAPHLCTHQD 193
AP P PP+ +++E G +R+ H + TD C ++
Sbjct: 217 APTTPTFSLPPV--------------LLRELSAFGRGMDLRLHSHLSETDNYVRFC--RE 260

Query: 192 RYK---------EDHLSPDTFFMSHCMKPCP*QIRSSVPSSINLGMTKCPSSNASLGT 46
RY+ D L PD +F +H + +IR + N GM CP SNA LG+
Sbjct: 261 RYQCSPVQFVADHDWLGPDVWF-AHLVAVTSEEIRMLAVT--NTGMAHCPVSNARLGS 315


>tr|B3R761|B3R761_CUPTR HYDROXY-ATRAZINE ETHYL AMINO HYDROLASE
PROTEIN OS=Cupriavidus taiwanensis (strain R1 / LMG
19424) GN=atzB PE=4 SV=1
Length = 467

Score = 33.5 bits (75), Expect = 6.4
Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 9/92 (9%)
Frame = -2

Query: 294 IIKEGYFITEGC*IRIFPHFA*TDAAPHLCTHQDRYK---------EDHLSPDTFFMSHC 142
+++E G +R+ H + TD C +++Y+ D L PD +F +H
Sbjct: 232 LLRELAAFGRGMDLRLHSHLSETDNYVKFC--REKYQCTPVQFVADHDWLGPDVWF-AHL 288

Query: 141 MKPCP*QIRSSVPSSINLGMTKCPSSNASLGT 46
+ P ++R + N GM CP SNA LG+
Sbjct: 289 VTVNPEEVRMLAVT--NTGMAHCPVSNARLGS 318