BP915698
Clone id YMU001_000074_G03
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000074_G03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAAGCTGTCATGGCATGCCAGATATTTGCTATTGCTTTTGAGTGTGATGTCGGTGATGAC
ATACATGAGCATTATAGCACCCTGGCAAGAGCAGCAATTCCTCTGCTACCAAAGAACAGC
AGGATCTTGAAGTTCATCGATTAGTTCGTGTAAAGTGAAATTGTTCAAATGACAAGGGAC
ACCATGTTTTCGAGCTGTTCAAAGAGCAGAGTATAGTTGCTATTGTATACTACGCAAACA
TACAGTACCATATGGCATTACCACTCTTCTAATGTGGTTAGAACTGATCTGTTTAAAAAA
AATGTAAGTATTATTTCGATGCAATCAAGTCATTCAACTGTATGGCTTTCCTGCTATATA
CCATGTGATGTGGGCCTTCGACTCGGCACATTATTCCACCTTCCATGGATTTAGATTTTG
GCCACAACAATTCCCCTCTCAAATCCTTATACGGAGTTGTCCACCCAATTATCAGTATTT
CGCTAAATAGTCCGTCACTTCAAGGTATGTATGTGGATACACCATTTCTTCACCCTCAAC
AAGTTCATCTTGATGACATACTTTGTTTCACAGGTGGATATTGCTCGTGTACACCTT
■■Homology search results ■■ -
sp_hit_id P48626
Definition sp|P48626|FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum
Align length 67
Score (bit) 32.0
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915698|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_G03.
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P48626|FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic... 32 2.4
sp|O29265|MTAD2_ARCFU 5-methylthioadenosine/S-adenosylhomocystei... 31 4.1
sp|O64474|AHM2_ARATH Putative cadmium/zinc-transporting ATPase 2... 30 9.2

>sp|P48626|FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic
reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1
Length = 379

Score = 32.0 bits (71), Expect = 2.4
Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%)
Frame = +2

Query: 227 ILRKHTVPYGITTLLMWLELICLKKM*VLFRCN-----QVIQLYGFPAIYHVMWAFDSAH 391
+ + H Y +T+ L W + L +L+ C Q+ ++YG P + VMW D
Sbjct: 200 LFQPHERKYVVTSTLCWTVMAAL----LLYLCTAFGSLQMFKIYGAPYLIFVMW-LDFVT 254

Query: 392 YSTFHGF 412
Y HG+
Sbjct: 255 YLHHHGY 261


>sp|O29265|MTAD2_ARCFU 5-methylthioadenosine/S-adenosylhomocysteine
deaminase 2 OS=Archaeoglobus fulgidus GN=mtaD2 PE=3 SV=1
Length = 416

Score = 31.2 bits (69), Expect = 4.1
Identities = 18/67 (26%), Positives = 28/67 (41%)
Frame = -3

Query: 211 LCSLNSSKTWCPLSFEQFHFTRTNR*TSRSCCSLVAEELLLLPGCYNAHVCHHRHHTQKQ 32
LC +N C + + T + R + A L++PGC+NAH H T +
Sbjct: 10 LCFINGEFVECSVGVDGNRITHVAKEVERGEIEIDAAGCLVMPGCFNAHT--HAAMTLLR 67

Query: 31 *QISGMP 11
G+P
Sbjct: 68 GYAEGLP 74


>sp|O64474|AHM2_ARATH Putative cadmium/zinc-transporting ATPase 2
OS=Arabidopsis thaliana GN=HMA4 PE=2 SV=2
Length = 1172

Score = 30.0 bits (66), Expect = 9.2
Identities = 14/35 (40%), Positives = 18/35 (51%)
Frame = -3

Query: 148 RTNR*TSRSCCSLVAEELLLLPGCYNAHVCHHRHH 44
R R + +SCC A+EL C + H HH HH
Sbjct: 1137 RAKRHSGKSCCRSYAKEL-----CSHRHHHHHHHH 1166


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915698|Adiantum capillus-veneris mRNA, clone:
YMU001_000074_G03.
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******