BP915721
Clone id YMU001_000076_A07
Library
Length 511
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATACAACGCTAGTGATTAATTTAGGTACCGATGAACTCAGTAAATTATTACATAACATAA
ACACACAGCAGCTAAGAGCACAATCACATCGACATTTACAATCAAATCAGAAATACGAGT
CTTTTACTTGAATCCCTGCTGGTCGTCATTTCCACATGGCAAATGCTCACATCTAAACAA
TCGGCATAACAATTAACAGATTGCTTTCAGAGCTCACATCGGAACCTTGGTCCTTGCAGT
GTTTTTGTAGAAGGCAATGCCAATCTTTAACATCATTCAAGCTTTTAGCACCAATTTTGA
AATGGGTGGCCTTAATGCCCCTTCAACTTGCCACTCCCATACAAACTTGGATTCCCCTTT
CACTAATTTTGGATACTGATCAATACGAGAGTCCTTACAAACCATCTGCTCCACCGCATG
CCAAACAGCATTATATTGGCGTTCCCTTAGTGTGAGAAGATGGTCTCGAAGATGTGATGC
AACAATCCACTTTTCATTTCCTGACGCATTG
■■Homology search results ■■ -
sp_hit_id Q6DVA0
Definition sp|Q6DVA0|LEMD2_MOUSE LEM domain-containing protein 2 OS=Mus musculus
Align length 50
Score (bit) 33.5
E-value 0.59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915721|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_A07.
(511 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6DVA0|LEMD2_MOUSE LEM domain-containing protein 2 OS=Mus mus... 33 0.59
sp|Q8NC56|LEMD2_HUMAN LEM domain-containing protein 2 OS=Homo sa... 33 0.59
sp|Q9WU40|MAN1_MOUSE Inner nuclear membrane protein Man1 OS=Mus ... 30 6.5

>sp|Q6DVA0|LEMD2_MOUSE LEM domain-containing protein 2 OS=Mus
musculus GN=Lemd2 PE=1 SV=1
Length = 511

Score = 33.5 bits (75), Expect = 0.59
Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
Frame = -2

Query: 474 HLRDHLLTLRERQ-YNAVW-HAVEQMVCKDSRIDQYPKLVKGESKFVWEW 331
H+RD L+ + R+ VW AVE + +SRI V GE VW W
Sbjct: 451 HVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRW 500


>sp|Q8NC56|LEMD2_HUMAN LEM domain-containing protein 2 OS=Homo
sapiens GN=LEMD2 PE=1 SV=1
Length = 503

Score = 33.5 bits (75), Expect = 0.59
Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
Frame = -2

Query: 474 HLRDHLLTLRERQ-YNAVW-HAVEQMVCKDSRIDQYPKLVKGESKFVWEW 331
H+RD L+ + R+ VW AVE + +SRI V GE VW W
Sbjct: 443 HVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRW 492


>sp|Q9WU40|MAN1_MOUSE Inner nuclear membrane protein Man1 OS=Mus
musculus GN=Lemd3 PE=1 SV=2
Length = 921

Score = 30.0 bits (66), Expect = 6.5
Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
Frame = -2

Query: 474 HLRDHLLTLRERQ-YNAVW-HAVEQMVCKDSRIDQYPKLVKGESKFVWEW 331
H+RD L+ ++R+ VW AV+ + +SR+ + V G VW W
Sbjct: 708 HVRDSLIQPQDRKKMKKVWDRAVDFLAANESRVRTETRRVGGADFLVWRW 757


tr_hit_id A7PCD9
Definition tr|A7PCD9|A7PCD9_VITVI Chromosome chr2 scaffold_11, whole genome shotgun sequence OS=Vitis vinifera
Align length 67
Score (bit) 88.2
E-value 2.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915721|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_A07.
(511 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PCD9|A7PCD9_VITVI Chromosome chr2 scaffold_11, whole genome... 88 2e-16
tr|B6T848|B6T848_MAIZE Putative uncharacterized protein OS=Zea m... 85 2e-15
tr|A9RFH2|A9RFH2_PHYPA Predicted protein OS=Physcomitrella paten... 84 5e-15
tr|Q9LS27|Q9LS27_ARATH Genomic DNA, chromosome 5, BAC clone:F10E... 82 2e-14
tr|B8AKZ7|B8AKZ7_ORYSI Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|A3AD52|A3AD52_ORYSJ Putative uncharacterized protein OS=Oryza... 82 2e-14
tr|B6S335|B6S335_9BILA Nuclear membrane protein XMAN1-like prote... 37 0.56
tr|B7PT17|B7PT17_IXOSC LEM domain-containing protein, putative O... 36 0.96
tr|B6MQ73|B6MQ73_BRAFL Putative uncharacterized protein OS=Branc... 35 2.8
tr|Q6C688|Q6C688_YARLI YALI0E11539p OS=Yarrowia lipolytica GN=YA... 34 3.7
tr|Q4UBV4|Q4UBV4_THEAN P-type ATPase 2, putative OS=Theileria an... 34 4.7
tr|A7RW30|A7RW30_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 4.7
tr|Q4KM57|Q4KM57_RAT LEM domain containing 2 OS=Rattus norvegicu... 33 6.2
tr|B4DVH5|B4DVH5_HUMAN cDNA FLJ55252, highly similar to Homo sap... 33 6.2
tr|A8MS91|A8MS91_HUMAN Putative uncharacterized protein LEMD2 OS... 33 6.2

>tr|A7PCD9|A7PCD9_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015822001
PE=4 SV=1
Length = 383

Score = 88.2 bits (217), Expect = 2e-16
Identities = 40/67 (59%), Positives = 51/67 (76%)
Frame = -2

Query: 495 EKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQVEGA 316
E W+V S LRDHLL +ER+ +W VE++V +DSR+D+YPKLVKGESK VWEWQVEG+
Sbjct: 285 EPWVVVSWLRDHLLLPKERKDPLLWRKVEELVQEDSRLDRYPKLVKGESKVVWEWQVEGS 344

Query: 315 LRPPISK 295
L + K
Sbjct: 345 LSSRLRK 351


>tr|B6T848|B6T848_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 383

Score = 84.7 bits (208), Expect = 2e-15
Identities = 38/71 (53%), Positives = 52/71 (73%)
Frame = -2

Query: 504 SGNEKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQV 325
S +E W+V S LRDHLL +ER+ +W VE+++ +DSRIDQYPK++KGESK V+EWQ
Sbjct: 263 SNSEVWVVTSWLRDHLLVPQERKNAFLWKKVEELIREDSRIDQYPKVIKGESKVVYEWQA 322

Query: 324 EGALRPPISKL 292
G+L I K+
Sbjct: 323 SGSLSAKIKKV 333


>tr|A9RFH2|A9RFH2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65420 PE=4 SV=1
Length = 350

Score = 83.6 bits (205), Expect = 5e-15
Identities = 37/60 (61%), Positives = 46/60 (76%)
Frame = -2

Query: 507 ASGNEKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQ 328
+SG KW+VAS LRDHLL ER+ +W VE++V +DSRIDQYPKLV G+S+ VWEWQ
Sbjct: 273 SSGETKWVVASRLRDHLLLPSERKVATLWKEVERLVQEDSRIDQYPKLVNGDSRVVWEWQ 332


>tr|Q9LS27|Q9LS27_ARATH Genomic DNA, chromosome 5, BAC clone:F10E10
OS=Arabidopsis thaliana PE=4 SV=1
Length = 375

Score = 82.0 bits (201), Expect = 2e-14
Identities = 40/71 (56%), Positives = 53/71 (74%)
Frame = -2

Query: 504 SGNEKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQV 325
S E W++AS LRD+LL RER+ +W VE+++ +DSRID+Y KL+KGE K VWEWQV
Sbjct: 277 SNCEPWVIASWLRDYLLLPRERRDPLLWTKVEELIKEDSRIDRYEKLLKGEKKVVWEWQV 336

Query: 324 EGALRPPISKL 292
EG+L +SKL
Sbjct: 337 EGSL--SLSKL 345


>tr|B8AKZ7|B8AKZ7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09603 PE=4 SV=1
Length = 339

Score = 81.6 bits (200), Expect = 2e-14
Identities = 36/61 (59%), Positives = 47/61 (77%)
Frame = -2

Query: 495 EKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQVEGA 316
E W+V S LRDHLL +ER+ +W VE+++ +DSRIDQYPK+VKGESK V+EWQ G+
Sbjct: 243 EPWVVTSWLRDHLLVPQERRNAFLWKKVEELILEDSRIDQYPKVVKGESKVVYEWQASGS 302

Query: 315 L 313
L
Sbjct: 303 L 303


>tr|A3AD52|A3AD52_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008724 PE=4 SV=1
Length = 313

Score = 81.6 bits (200), Expect = 2e-14
Identities = 36/61 (59%), Positives = 47/61 (77%)
Frame = -2

Query: 495 EKWIVASHLRDHLLTLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEWQVEGA 316
E W+V S LRDHLL +ER+ +W VE+++ +DSRIDQYPK+VKGESK V+EWQ G+
Sbjct: 217 EPWVVTSWLRDHLLVPQERRNAFLWKKVEELILEDSRIDQYPKVVKGESKVVYEWQASGS 276

Query: 315 L 313
L
Sbjct: 277 L 277


>tr|B6S335|B6S335_9BILA Nuclear membrane protein XMAN1-like protein
OS=Philodina roseola PE=4 SV=1
Length = 658

Score = 37.0 bits (84), Expect = 0.56
Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
Frame = -2

Query: 504 SGNEKWIVASHLRDHLLTLRER-QYNAVWHAVEQMVCK-DSRIDQYPKLVKGESKFVWEW 331
+ + W+ SH+RD L+ + +R + +W ++ + + +SR+ +++ GE VW W
Sbjct: 457 TNTQPWLAISHIRDMLIPVADRKKLKELWQRAQKQISESESRVRAETQVIHGEEFDVWRW 516


>tr|B7PT17|B7PT17_IXOSC LEM domain-containing protein, putative
OS=Ixodes scapularis GN=IscW_ISCW006995 PE=4 SV=1
Length = 660

Score = 36.2 bits (82), Expect = 0.96
Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
Frame = -2

Query: 495 EKWIVASHLRDHLLTLRER-QYNAVW-HAVEQMVCKDSRIDQYPKLVKGESKFVWEWQVE 322
E ++ H+RD L+ +R Q + +W +AV+ + +SR+ + + GES VW W +
Sbjct: 433 EPYLAQVHVRDMLIEPSQRKQLSQLWQNAVDFLGRNESRVRTERQHIDGESYLVWRW-LG 491

Query: 321 GALRPP 304
GA PP
Sbjct: 492 GAASPP 497


>tr|B6MQ73|B6MQ73_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_85286 PE=4 SV=1
Length = 1046

Score = 34.7 bits (78), Expect = 2.8
Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 6/74 (8%)
Frame = -2

Query: 495 EKWIVASHLRDHLLTLRERQ-YNAVW-HAVEQMVCKDSRIDQYPKLVKGESKFVWEW--- 331
+ ++ H+RD L+ +ER+ VW AV+ + +SRI + + GE VW W
Sbjct: 798 QPYLAIPHVRDMLIPPQERKKLGQVWDRAVKFLSANESRIRVESQQISGEPFTVWRWINV 857

Query: 330 -QVEGALRPPISKL 292
L PPI++L
Sbjct: 858 DTPNNRLYPPINEL 871


>tr|Q6C688|Q6C688_YARLI YALI0E11539p OS=Yarrowia lipolytica
GN=YALI0E11539g PE=4 SV=2
Length = 921

Score = 34.3 bits (77), Expect = 3.7
Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
Frame = -2

Query: 492 KWIVASHLRDHLL--TLRERQYNAVWHAVEQMVCKDSRIDQYPKLVKGESKFVWEW 331
+++ LRD LL T ++ ++W V V +++ ++ K V+GE VWEW
Sbjct: 861 RFLPVPQLRDELLVDTATSKRKASLWKKVADTVEQNANVESQTKEVRGEVTRVWEW 916