BP915727
Clone id YMU001_000076_B04
Library
Length 500
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCAGTGTATGGCCTAAAGCAAGGCTCAAGGCAGCGGTACCAGAAGTTTGACAAGTACGT
GCACTCCCAAGGTTATGTACAGAGCCAAGAAAATCACTGCTTATATACCTGGAAGTTGAA
CAATGGTTCACTTATCATCTTGACACTTTATGGTGATGATATGCTTATTGCGAAGAAGTC
TAAAGACAAGATTGCCATCTTGAAGAAGTCAACTAGAATGCACTTTGCTATGAAGGATTT
GGGAGATGCAAGTCACTTTCTTGGTATGCATATCAAAAGGGATAGGAAATGTGGAATACT
AGAGTTACCTCAGGAAACATATATCCATAAGGTCTTGCAACATTTTAATATGCAGGGTGG
GAAGCTACATTGAGTACCCCAATGTAGACATATGAAAAACTTAGCAAGAATGATGCTCCC
AAATTTGATGCTGAAAAGAAAAAATGGCAAAGGTGCCATATTCTTTGCATACTAGATAGT
TTCATGTATGCCATGGTAGC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 148
Score (bit) 96.7
E-value 5.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915727|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_B04.
(500 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 97 5e-20
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 56 1e-07
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W O... 43 0.001
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Sa... 33 0.74
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Sa... 33 0.74
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg0... 30 4.8

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 96.7 bits (239), Expect = 5e-20
Identities = 56/148 (37%), Positives = 78/148 (52%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ RQ Y KFD ++ SQ Y+++ + C+Y + + + IIL LY DDM
Sbjct: 959 SLYGLKQAPRQWYMKFDSFMKSQTYLKTYSDPCVYFKRFSENNFIILLLYVDDMLIVGKD 1018

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
F MKDLG A LGM I R+R L L QE YI +VL+ FNM+
Sbjct: 1019 KGLIAKLKGDLSKSFDMKDLGPAQQILGMKIVRERTSRKLWLSQEKYIERVLERFNMKNA 1078

Query: 362 KLH*VPQCRHMKNLARMMLPNLMLKRKN 445
K P H+K L++ M P + ++ N
Sbjct: 1079 KPVSTPLAGHLK-LSKKMCPTTVEEKGN 1105


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP
PE=1 SV=3
Length = 1409

Score = 55.8 bits (133), Expect = 1e-07
Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 1/119 (0%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTW-KLNNGSLIILTLYGDDMXXXXX 178
A+YGLKQ +R ++ F++ + +V S + C+Y K N I + LY DD+
Sbjct: 1037 AIYGLKQAARCWFEVFEQALKECEFVNSSVDRCIYILDKGNINENIYVLLYVDDVVIATG 1096

Query: 179 XXXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQ 355
F M DL + HF+G+ I+ + L Q Y+ K+L FNM+
Sbjct: 1097 DMTRMNNFKRYLMEKFRMTDLNEIKHFIGIRIEMQE--DKIYLSQSAYVKKILSKFNME 1153


>sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W
OS=Saccharomyces cerevisiae GN=TY5A PE=4 SV=2
Length = 308

Score = 42.7 bits (99), Expect = 0.001
Identities = 36/141 (25%), Positives = 58/141 (41%)
Frame = +2

Query: 5 VYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXXX 184
+YGLKQ + + + G+ + + H LY ++G + I +Y DD+
Sbjct: 40 MYGLKQAPLLWNEHINNTLKKIGFCRHEGEHGLYFRSTSDGPIYI-AVYVDDLLVAAPSP 98

Query: 185 XXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGGK 364
++MKDLG FLG++I + G + L + YI K + K
Sbjct: 99 KIYDRVKQELTKLYSMKDLGKVDKFLGLNIHQSSN-GDITLSLQDYIAKAASESEINTFK 157

Query: 365 LH*VPQCRHMKNLARMMLPNL 427
L P C + K L P+L
Sbjct: 158 LTQTPLC-NSKPLFETTSPHL 177


>sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY4B-J PE=2 SV=2
Length = 1803

Score = 33.1 bits (74), Expect = 0.74
Identities = 25/128 (19%), Positives = 57/128 (44%), Gaps = 6/128 (4%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
A+YGLKQ ++ +Y++ G + LY + N +++ +Y DD
Sbjct: 1415 ALYGLKQSPKEWNDHLRQYLNGIGLKDNSYTPGLYQTEDKN---LMIAVYVDDCVIAASN 1471

Query: 182 XXXXXXXXXXTRMHFAMKDLGDA------SHFLGMHIKRDRKCGILELPQETYIHKVLQH 343
+ +F +K G + LGM + +++ G ++L +++I+++ +
Sbjct: 1472 EQRLDEFINKLKSNFELKITGTLIDDVLDTDILGMDLVYNKRLGTIDLTLKSFINRMDKK 1531

Query: 344 FNMQGGKL 367
+N + K+
Sbjct: 1532 YNEELKKI 1539


>sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY4B-H PE=2 SV=1
Length = 1802

Score = 33.1 bits (74), Expect = 0.74
Identities = 25/128 (19%), Positives = 57/128 (44%), Gaps = 6/128 (4%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
A+YGLKQ ++ +Y++ G + LY + N +++ +Y DD
Sbjct: 1414 ALYGLKQSPKEWNDHLRQYLNGIGLKDNSYTPGLYQTEDKN---LMIAVYVDDCVIAASN 1470

Query: 182 XXXXXXXXXXTRMHFAMKDLGDA------SHFLGMHIKRDRKCGILELPQETYIHKVLQH 343
+ +F +K G + LGM + +++ G ++L +++I+++ +
Sbjct: 1471 EQRLDEFINKLKSNFELKITGTLIDDVLDTDILGMDLVYNKRLGTIDLTLKSFINRMDKK 1530

Query: 344 FNMQGGKL 367
+N + K+
Sbjct: 1531 YNEELKKI 1538


>sp|P92519|M810_ARATH Uncharacterized mitochondrial protein
AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1
Length = 240

Score = 30.4 bits (67), Expect = 4.8
Identities = 22/71 (30%), Positives = 29/71 (40%)
Frame = +2

Query: 140 LTLYGDDMXXXXXXXXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQET 319
L LY DD+ F+MKDLG +FLG+ IK L L Q
Sbjct: 3 LLLYVDDILLTGSSNTLLNMLIFQLSSTFSMKDLGPVHYFLGIQIKTHPSG--LFLSQTK 60

Query: 320 YIHKVLQHFNM 352
Y ++L + M
Sbjct: 61 YAEQILNNAGM 71


tr_hit_id A5AMT8
Definition tr|A5AMT8|A5AMT8_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 132
Score (bit) 97.1
E-value 1.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915727|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_B04.
(500 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5AMT8|A5AMT8_VITVI Putative uncharacterized protein OS=Vitis... 97 1e-22
tr|Q153Y5|Q153Y5_SOLME Polyprotein (Fragment) OS=Solanum melonge... 96 2e-21
tr|A5B7I7|A5B7I7_VITVI Putative uncharacterized protein OS=Vitis... 95 2e-20
tr|Q9SHR5|Q9SHR5_ARATH F28L22.3 protein OS=Arabidopsis thaliana ... 101 2e-20
tr|B8YLY7|B8YLY7_LOTJA Gag-Pol polyprotein OS=Lotus japonicus PE... 92 3e-20
tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis... 90 3e-20
tr|Q5GA69|Q5GA69_SOLLC Putative polyprotein OS=Solanum lycopersi... 100 5e-20
tr|A5BE46|A5BE46_VITVI Putative uncharacterized protein (Fragmen... 93 7e-20
tr|A5BKR0|A5BKR0_VITVI Putative uncharacterized protein OS=Vitis... 93 7e-20
tr|A5B591|A5B591_VITVI Putative uncharacterized protein OS=Vitis... 93 7e-20
tr|Q9FFM0|Q9FFM0_ARATH Copia-like retrotransposable element OS=A... 99 8e-20
tr|A5APP5|A5APP5_VITVI Putative uncharacterized protein OS=Vitis... 93 9e-20
tr|Q9ZRJ0|Q9ZRJ0_TOBAC Retrotransposon Tto1 DNA OS=Nicotiana tab... 99 1e-19
tr|A5AQ94|A5AQ94_VITVI Putative uncharacterized protein OS=Vitis... 98 2e-19
tr|Q75HA9|Q75HA9_ORYSJ Putative polyprotein (Retrotransposon pro... 98 2e-19
tr|A5BG32|A5BG32_VITVI Putative uncharacterized protein OS=Vitis... 89 3e-19
tr|A5BPU0|A5BPU0_VITVI Putative uncharacterized protein OS=Vitis... 97 3e-19
tr|Q0DX39|Q0DX39_ORYSJ Os02g0776400 protein OS=Oryza sativa subs... 97 4e-19
tr|A5C0J2|A5C0J2_VITVI Putative uncharacterized protein OS=Vitis... 89 5e-19
tr|A5ADH5|A5ADH5_VITVI Putative uncharacterized protein OS=Vitis... 89 5e-19
tr|A5BYJ3|A5BYJ3_VITVI Putative uncharacterized protein OS=Vitis... 97 5e-19
tr|A5BM67|A5BM67_VITVI Putative uncharacterized protein (Fragmen... 97 5e-19
tr|A5B5Y8|A5B5Y8_VITVI Putative uncharacterized protein OS=Vitis... 97 5e-19
tr|A5B3N9|A5B3N9_VITVI Putative uncharacterized protein OS=Vitis... 97 5e-19
tr|A5ADX1|A5ADX1_VITVI Putative uncharacterized protein OS=Vitis... 84 6e-19
tr|A5AHT8|A5AHT8_VITVI Putative uncharacterized protein OS=Vitis... 89 6e-19
tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis... 96 7e-19
tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis... 96 7e-19
tr|A5C9A6|A5C9A6_VITVI Putative uncharacterized protein OS=Vitis... 96 7e-19
tr|A5BK92|A5BK92_VITVI Putative uncharacterized protein OS=Vitis... 96 7e-19

>tr|A5AMT8|A5AMT8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005778 PE=4 SV=1
Length = 1024

Score = 97.1 bits (240), Expect(2) = 1e-22
Identities = 55/132 (41%), Positives = 68/132 (51%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ RQ Y+KFD ++H G+ + + +HC Y +N S IIL LY DDM
Sbjct: 749 SLYGLKQAPRQWYKKFDSFMHRIGFKRCEADHCCYVKSFDN-SYIILLLYVDDMLIAGSD 807

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
FAMKDLG A LGM I RD+ G L+L Q Y+ KVL FNM
Sbjct: 808 IEKINNLKKQLSKQFAMKDLGAAKQILGMRIIRDKANGTLKLSQSEYVKKVLSRFNMNEA 867

Query: 362 KLH*VPQCRHMK 397
K P H K
Sbjct: 868 KPXSTPLGSHFK 879



Score = 32.7 bits (73), Expect(2) = 1e-22
Identities = 16/42 (38%), Positives = 24/42 (57%)
Frame = +1

Query: 373 STPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
STP+ ++ KLSK +PK + E+ + + S MYAMV
Sbjct: 871 STPLGSHFKLSKEQSPKTEEERDHMSKVPYASAIGSLMYAMV 912


>tr|Q153Y5|Q153Y5_SOLME Polyprotein (Fragment) OS=Solanum melongena
PE=4 SV=1
Length = 361

Score = 95.9 bits (237), Expect(2) = 2e-21
Identities = 50/113 (44%), Positives = 65/113 (57%)
Frame = +2

Query: 14 LKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXXXXXX 193
+KQ SRQ Y++FDK++ Q Y +S+ +HC+Y KL NGS + L LY DDM
Sbjct: 41 MKQSSRQWYKQFDKFMQDQRYTRSKYDHCVYFHKLQNGSYVYLLLYVDDMLIAAKSQFEI 100

Query: 194 XXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNM 352
F MKDLG+A LGM I RDR+ G L L Q+ Y+ KVLQ F +
Sbjct: 101 DRLKAQLSKEFEMKDLGEAKKILGMEISRDRQRGKLCLTQKQYLKKVLQRFGI 153



Score = 29.3 bits (64), Expect(2) = 2e-21
Identities = 16/43 (37%), Positives = 24/43 (55%)
Frame = +1

Query: 370 LSTPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
+STP+ + KLS +PK D E++ + + S MYAMV
Sbjct: 160 VSTPLAPHLKLSSQLSPKTDEEREYMAKVPYANAVGSLMYAMV 202


>tr|A5B7I7|A5B7I7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004411 PE=4 SV=1
Length = 872

Score = 95.1 bits (235), Expect(2) = 2e-20
Identities = 55/126 (43%), Positives = 67/126 (53%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ SRQ Y KF + + S G+ + + C+Y K + I L LY DD+
Sbjct: 516 SIYGLKQASRQWYFKFHQIIVSYGFEANLMDECVYH-KFSGSKYIFLVLYVDDILLATND 574

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
HF MKDLGDAS LG+ I RDR GIL L Q TYI KVLQ + MQ
Sbjct: 575 ISILHDTKRFLSKHFEMKDLGDASFVLGIQIHRDRSRGILGLSQRTYIDKVLQRYGMQNS 634

Query: 362 KLH*VP 379
KL P
Sbjct: 635 KLGDTP 640



Score = 26.9 bits (58), Expect(2) = 2e-20
Identities = 14/41 (34%), Positives = 20/41 (48%)
Frame = +1

Query: 376 TPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
TP+ +K S N PK E ++ Q+ + S MYA V
Sbjct: 639 TPVAKGDKFSLNQCPKNSLESQEMQKIPYASAVGSLMYAQV 679


>tr|Q9SHR5|Q9SHR5_ARATH F28L22.3 protein OS=Arabidopsis thaliana
GN=F28L22.3 PE=4 SV=1
Length = 1356

Score = 101 bits (251), Expect = 2e-20
Identities = 53/132 (40%), Positives = 73/132 (55%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ RQ ++FD+++ SQ +++S+ + C+Y ++ I L LY DDM
Sbjct: 988 SLYGLKQSPRQWNKRFDRFMSSQQFIRSEHDACVYVKHVSEHDFIYLLLYVDDMLIAGAS 1047

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
F MKD+G AS LG+ I RDRK G+L+L QE YI KVL FNM G
Sbjct: 1048 KAEINRVKEQLSTEFEMKDMGGASRILGIDIYRDRKGGVLKLSQEIYIRKVLDRFNMSGA 1107

Query: 362 KLH*VPQCRHMK 397
K+ P H K
Sbjct: 1108 KMTNAPVGAHFK 1119


>tr|B8YLY7|B8YLY7_LOTJA Gag-Pol polyprotein OS=Lotus japonicus PE=4
SV=1
Length = 1305

Score = 92.0 bits (227), Expect(2) = 3e-20
Identities = 49/118 (41%), Positives = 65/118 (55%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ R Y++FD ++ S GY + +HC Y + ++G IIL LY DDM
Sbjct: 936 SLYGLKQAPRCWYKRFDSFIMSLGYNRLSSDHCTYYKRFDDGDFIILLLYVDDMLVVGPN 995

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQ 355
F MKDLG A+ LGM I RDRK + L Q+ Y+ KVL+ FNMQ
Sbjct: 996 KDRVQELKAQLAREFDMKDLGPANKILGMQIHRDRKDRKIWLSQKNYLQKVLRRFNMQ 1053



Score = 29.6 bits (65), Expect(2) = 3e-20
Identities = 15/43 (34%), Positives = 23/43 (53%)
Frame = +1

Query: 370 LSTPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
+STP+ KLS + P +AE+ + R + S MYAM+
Sbjct: 1058 ISTPLPVNYKLSSSMIPSSEAERMEMSRVPYASAVGSLMYAMI 1100


>tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024659 PE=4 SV=1
Length = 1287

Score = 90.1 bits (222), Expect(2) = 3e-20
Identities = 55/138 (39%), Positives = 68/138 (49%), Gaps = 6/138 (4%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ RQ Y+KFD +H G+ + + +HC Y +N S IIL LY DDM
Sbjct: 914 SLYGLKQAPRQWYKKFDNXMHRIGFKRCEADHCCYVKSFDN-SYIILLLYVDDMLIVGSD 972

Query: 182 XXXXXXXXXXTRM------HFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQH 343
+ FAMKDLG A LGM I RD+ G L+L Q Y+ KVL
Sbjct: 973 IEKINNLKKINNLKKQLSKQFAMKDLGAAKQILGMRIIRDKANGTLKLSQSEYVKKVLSR 1032

Query: 344 FNMQGGKLH*VPQCRHMK 397
FNM K P H K
Sbjct: 1033 FNMNEAKPVXTPLGSHFK 1050



Score = 31.2 bits (69), Expect(2) = 3e-20
Identities = 15/41 (36%), Positives = 23/41 (56%)
Frame = +1

Query: 376 TPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
TP+ ++ KLSK +PK + E+ + + S MYAMV
Sbjct: 1043 TPLGSHFKLSKEQSPKTEEERDHMSKVPYASAIGSLMYAMV 1083


>tr|Q5GA69|Q5GA69_SOLLC Putative polyprotein OS=Solanum lycopersicum
PE=4 SV=1
Length = 687

Score = 100 bits (248), Expect = 5e-20
Identities = 55/132 (41%), Positives = 69/132 (52%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ RQ Y KFD ++ + Y ++ + C+Y K + G+ IIL LY DDM
Sbjct: 319 SLYGLKQAPRQWYHKFDSFMSNNEYKRTTADPCVYFRKFSEGNFIILCLYVDDMLIVGQD 378

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
F MKDLG A LGM I RDRK G L L QE YI +VL+ FNM+
Sbjct: 379 VEMICRLKEDLSKSFDMKDLGPAKQILGMEIARDRKAGKLWLSQENYIERVLERFNMKNA 438

Query: 362 KLH*VPQCRHMK 397
K P H K
Sbjct: 439 KPVNTPLAAHFK 450


>tr|A5BE46|A5BE46_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_025855 PE=4 SV=1
Length = 1356

Score = 93.2 bits (230), Expect(2) = 7e-20
Identities = 53/121 (43%), Positives = 65/121 (53%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ SRQ Y KF + + S G+ + + C+Y K + I L LY DD+
Sbjct: 979 SIYGLKQASRQWYFKFHQIIVSYGFEANLMDECVYH-KFSGSKYIFLVLYVDDILLATND 1037

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
HF MKDLGDAS LG+ I RDR GIL L Q TYI KVLQ + MQ
Sbjct: 1038 ISILHDTKRFLSKHFEMKDLGDASFVLGIQIHRDRSRGILGLSQRTYIDKVLQRYGMQNS 1097

Query: 362 K 364
K
Sbjct: 1098 K 1098



Score = 26.9 bits (58), Expect(2) = 7e-20
Identities = 14/41 (34%), Positives = 20/41 (48%)
Frame = +1

Query: 376 TPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
TP+ +K S N PK E ++ Q+ + S MYA V
Sbjct: 1102 TPVAKGDKFSLNQCPKNSLESQEMQKIPYASAVGSLMYAQV 1142


>tr|A5BKR0|A5BKR0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031073 PE=4 SV=1
Length = 1354

Score = 93.2 bits (230), Expect(2) = 7e-20
Identities = 53/121 (43%), Positives = 65/121 (53%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ SRQ Y KF + + S G+ + + C+Y K + I L LY DD+
Sbjct: 977 SIYGLKQASRQWYFKFHQIIVSYGFEANLMDECVYH-KFSGSKYIFLVLYVDDILLATND 1035

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
HF MKDLGDAS LG+ I RDR GIL L Q TYI KVLQ + MQ
Sbjct: 1036 ISILHDTKRFLSKHFEMKDLGDASFVLGIQIHRDRSRGILGLSQRTYIDKVLQRYGMQNS 1095

Query: 362 K 364
K
Sbjct: 1096 K 1096



Score = 26.9 bits (58), Expect(2) = 7e-20
Identities = 14/41 (34%), Positives = 20/41 (48%)
Frame = +1

Query: 376 TPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
TP+ +K S N PK E ++ Q+ + S MYA V
Sbjct: 1100 TPVAKGDKFSLNQCPKNSLESQEMQKIPYASAVGSLMYAQV 1140


>tr|A5B591|A5B591_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_019901 PE=4 SV=1
Length = 1083

Score = 93.2 bits (230), Expect(2) = 7e-20
Identities = 53/121 (43%), Positives = 65/121 (53%)
Frame = +2

Query: 2 AVYGLKQGSRQRYQKFDKYVHSQGYVQSQENHCLYTWKLNNGSLIILTLYGDDMXXXXXX 181
++YGLKQ SRQ Y KF + + S G+ + + C+Y K + I L LY DD+
Sbjct: 716 SIYGLKQASRQWYFKFHQIIVSYGFEANLMDECVYH-KFSGSKYIFLVLYVDDILLATND 774

Query: 182 XXXXXXXXXXTRMHFAMKDLGDASHFLGMHIKRDRKCGILELPQETYIHKVLQHFNMQGG 361
HF MKDLGDAS LG+ I RDR GIL L Q TYI KVLQ + MQ
Sbjct: 775 ISILHDTKRFLSKHFEMKDLGDASFVLGIQIHRDRSRGILGLSQRTYIDKVLQRYGMQNS 834

Query: 362 K 364
K
Sbjct: 835 K 835



Score = 26.9 bits (58), Expect(2) = 7e-20
Identities = 14/41 (34%), Positives = 20/41 (48%)
Frame = +1

Query: 376 TPM*TYEKLSKNDAPKFDAEKKKWQRCHILCILDSFMYAMV 498
TP+ +K S N PK E ++ Q+ + S MYA V
Sbjct: 839 TPVAKGDKFSLNQCPKNSLESQEMQKIPYASAVGSLMYAQV 879