BP915758
Clone id YMU001_000076_E03
Library
Length 478
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAGGATCTAAGTCATGCGGGTGCATTTCGTTGACCGCTTTGTTGAAGCCTTGCACTACT
ATTCAGCTCTTTTCGACTCTGTAGGGGAGAGTCATGCTGAGAGCAGTGAGGAGCGACATG
CTGTGGAACAGCAATTGTTCTCGAGTGAGATGAAGAACATTGTGGCCGTTGGGGGTCCAG
CTAGAACAGGGGAAGTGAAGTACGATAATTGGAAGACTGTCATGGGCAGTGCTGGGTTCA
AGCAAGTTTCACTCGCTGGAAATGCTACAACACAAGCCACTTTGTTGTTAAACATGTTCC
CTAGTGAAGGCTACTCACTTTCGGAGGAAGACGGGGTTCTTAAGCTGGGGTGGAAAGACC
TTAGTTTGTACACAGCTTCAGCTTGGTGTTGGCCAGCATCGCTTCATCACCTGTAGATTG
GAGCAAAATATACACTGGATGGAAGCCTGAAGGAGATGTTGAGCAGTGCTTGTGTGGA
■■Homology search results ■■ -
sp_hit_id Q9M384
Definition sp|Q9M384|SCR_ARATH Protein SCARECROW OS=Arabidopsis thaliana
Align length 120
Score (bit) 155.0
E-value 9.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915758|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E03.
(478 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9M384|SCR_ARATH Protein SCARECROW OS=Arabidopsis thaliana GN... 155 9e-38
sp|Q9AVK4|SCR_PEA Protein SCARECROW OS=Pisum sativum GN=SCR PE=2... 153 3e-37
sp|Q2Z2E9|SCR_IPONI Protein SCARECROW OS=Ipomoea nil GN=SCR PE=1... 149 6e-36
sp|Q9FUZ7|SCR_MAIZE Protein SCARECROW OS=Zea mays GN=SCR PE=2 SV=1 145 9e-35
sp|Q2QYF3|SCR2_ORYSJ Protein SCARECROW 2 OS=Oryza sativa subsp. ... 144 3e-34
sp|A2ZHL0|SCR2_ORYSI Protein SCARECROW 2 OS=Oryza sativa subsp. ... 144 3e-34
sp|Q2RB59|SCR1_ORYSJ Protein SCARECROW 1 OS=Oryza sativa subsp. ... 144 3e-34
sp|A2ZAX5|SCR1_ORYSI Protein SCARECROW 1 OS=Oryza sativa subsp. ... 144 3e-34
sp|Q9FHZ1|SCL23_ARATH Scarecrow-like protein 23 OS=Arabidopsis t... 117 3e-26
sp|Q8S4W7|GAI1_VITVI DELLA protein GAI1 OS=Vitis vinifera GN=GAI... 83 6e-16
sp|Q9LQT8|GAI_ARATH DELLA protein GAI OS=Arabidopsis thaliana GN... 80 4e-15
sp|Q6EI06|GAIP_CUCMA DELLA protein GAIP OS=Cucurbita maxima GN=G... 79 1e-14
sp|Q5BN22|RGA2_BRACM DELLA protein RGA2 OS=Brassica campestris G... 78 2e-14
sp|Q9C8Y3|RGL1_ARATH DELLA protein RGL1 OS=Arabidopsis thaliana ... 78 2e-14
sp|Q6EI05|GAIPB_CUCMA DELLA protein GAIP-B OS=Cucurbita maxima G... 77 4e-14
sp|Q8GXW1|RGL2_ARATH DELLA protein RGL2 OS=Arabidopsis thaliana ... 77 5e-14
sp|Q9SLH3|RGA_ARATH DELLA protein RGA OS=Arabidopsis thaliana GN... 77 5e-14
sp|Q9LF53|RGL3_ARATH DELLA protein RGL3 OS=Arabidopsis thaliana ... 76 9e-14
sp|Q8W127|SLN1_HORVU DELLA protein SLN1 OS=Hordeum vulgare GN=SL... 75 1e-13
sp|Q5BN23|RGA1_BRACM DELLA protein RGA1 OS=Brassica campestris G... 75 1e-13
sp|Q7Y1B6|GAI_SOLLC DELLA protein GAI OS=Solanum lycopersicum GN... 75 2e-13
sp|Q9ST48|DWRF8_MAIZE DELLA protein DWARF8 OS=Zea mays GN=D8 PE=... 74 4e-13
sp|Q9ST59|RHT1_WHEAT DELLA protein RHT-1 OS=Triticum aestivum GN... 73 6e-13
sp|Q7G7J6|SLR1_ORYSJ DELLA protein SLR1 OS=Oryza sativa subsp. j... 73 7e-13
sp|Q84TQ7|GAI_GOSHI DELLA protein GAI OS=Gossypium hirsutum GN=G... 73 7e-13
sp|Q8GVE1|CIGR2_ORYSJ Chitin-inducible gibberellin-responsive pr... 69 1e-11
sp|Q9ZWC5|SCL18_ARATH Scarecrow-like protein 18 OS=Arabidopsis t... 68 2e-11
sp|Q9LPR8|SCL3_ARATH Scarecrow-like protein 3 OS=Arabidopsis tha... 68 2e-11
sp|Q9FL03|SCL4_ARATH Scarecrow-like protein 4 OS=Arabidopsis tha... 66 7e-11
sp|Q9S7H5|SCL21_ARATH Scarecrow-like protein 21 OS=Arabidopsis t... 65 2e-10

>sp|Q9M384|SCR_ARATH Protein SCARECROW OS=Arabidopsis thaliana
GN=SCR PE=1 SV=1
Length = 653

Score = 155 bits (392), Expect = 9e-38
Identities = 73/120 (60%), Positives = 92/120 (76%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+GEVK++
Sbjct: 530 FLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFE 589

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ M GFK +SLAGNA TQATLLL MFPS+GY+L +++G LKLGWKDLSL TASAW
Sbjct: 590 SWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASAW 649


>sp|Q9AVK4|SCR_PEA Protein SCARECROW OS=Pisum sativum GN=SCR PE=2 SV=1
Length = 819

Score = 153 bits (387), Expect = 3e-37
Identities = 72/120 (60%), Positives = 91/120 (75%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+GE+K+
Sbjct: 686 FLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGEIKFH 745

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ + GF+ VSLAGNA TQA+LLL MFPSEGY+L E++G+LKLGWKDL L TASAW
Sbjct: 746 NWREKLQQCGFRGVSLAGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAW 805


>sp|Q2Z2E9|SCR_IPONI Protein SCARECROW OS=Ipomoea nil GN=SCR PE=1 SV=1
Length = 783

Score = 149 bits (376), Expect(2) = 6e-36
Identities = 71/120 (59%), Positives = 90/120 (75%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+GEVK++
Sbjct: 657 FLGRFVEAIHYYSALFDSLGACYGEESEERHAVEQQLLSREIRNVLAVGGPSRSGEVKFN 716

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ +GF+ VSLAGNA QATLLL MF S+GY+L+E++G LKLGWKDL L TASAW
Sbjct: 717 NWREKFQQSGFRGVSLAGNAAAQATLLLGMFHSDGYTLAEDNGALKLGWKDLCLLTASAW 776



Score = 21.6 bits (44), Expect(2) = 6e-36
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = +2

Query: 2 QDLSHAGAF 28
QDLSHAG+F
Sbjct: 649 QDLSHAGSF 657


>sp|Q9FUZ7|SCR_MAIZE Protein SCARECROW OS=Zea mays GN=SCR PE=2 SV=1
Length = 668

Score = 145 bits (366), Expect = 9e-35
Identities = 69/120 (57%), Positives = 88/120 (73%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 540 FLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 599

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA+LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 600 SWREKLAQSGFRAASLAGSAAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAW 659


>sp|Q2QYF3|SCR2_ORYSJ Protein SCARECROW 2 OS=Oryza sativa subsp.
japonica GN=SCR2 PE=2 SV=1
Length = 660

Score = 144 bits (362), Expect = 3e-34
Identities = 69/120 (57%), Positives = 87/120 (72%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 533 FLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 592

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 593 SWREKLAQSGFRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAW 652


>sp|A2ZHL0|SCR2_ORYSI Protein SCARECROW 2 OS=Oryza sativa subsp.
indica GN=SCR2 PE=3 SV=2
Length = 660

Score = 144 bits (362), Expect = 3e-34
Identities = 69/120 (57%), Positives = 87/120 (72%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 533 FLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 592

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 593 SWREKLAQSGFRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAW 652


>sp|Q2RB59|SCR1_ORYSJ Protein SCARECROW 1 OS=Oryza sativa subsp.
japonica GN=SCR1 PE=1 SV=1
Length = 651

Score = 144 bits (362), Expect = 3e-34
Identities = 69/120 (57%), Positives = 87/120 (72%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 524 FLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 583

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 584 SWREKLAQSGFRVSSLAGSAAAQAVLLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAW 643


>sp|A2ZAX5|SCR1_ORYSI Protein SCARECROW 1 OS=Oryza sativa subsp.
indica GN=SCR1 PE=3 SV=2
Length = 659

Score = 144 bits (362), Expect = 3e-34
Identities = 69/120 (57%), Positives = 87/120 (72%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 532 FLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 591

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 592 SWREKLAQSGFRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAW 651


>sp|Q9FHZ1|SCL23_ARATH Scarecrow-like protein 23 OS=Arabidopsis
thaliana GN=SCL23 PE=1 SV=1
Length = 405

Score = 117 bits (293), Expect = 3e-26
Identities = 63/120 (52%), Positives = 75/120 (62%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEALHYYSALFD++G Q + +E++NIVA GG G K
Sbjct: 284 FLGRFVEALHYYSALFDALGDGLGEESGERFTVEQIVLGTEIRNIVAHGG----GRRKRM 339

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
WK + GF+ VSL GN TQA LLL M P GY+L EE+G L+LGWKDLSL TASAW
Sbjct: 340 KWKEELSRVGFRPVSLRGNPATQAGLLLGMLPWNGYTLVEENGTLRLGWKDLSLLTASAW 399


>sp|Q8S4W7|GAI1_VITVI DELLA protein GAI1 OS=Vitis vinifera GN=GAI1
PE=2 SV=1
Length = 590

Score = 83.2 bits (204), Expect = 6e-16
Identities = 48/123 (39%), Positives = 65/123 (52%), Gaps = 3/123 (2%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSV-GXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVK- 200
F+DRF E+LHYYS LFDS+ G + ++ N+VA GP R +
Sbjct: 452 FLDRFTESLHYYSTLFDSLEGCGVSPVNTQDKLMSEVYLGQQICNVVACEGPERVERHET 511

Query: 201 YDNWKTVMGSAGFKQVSLAGNATTQATLLLNMFP-SEGYSLSEEDGVLKLGWKDLSLYTA 377
W+ +GSAGF V+L NA QA++LL +F +GY + E +G L LGW L
Sbjct: 512 LAQWRARLGSAGFDPVNLGSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIAT 571

Query: 378 SAW 386
SAW
Sbjct: 572 SAW 574


tr_hit_id Q0MRQ2
Definition tr|Q0MRQ2|Q0MRQ2_PINSY SCARECROW OS=Pinus sylvestris
Align length 120
Score (bit) 158.0
E-value 1.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915758|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E03.
(478 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0MRQ2|Q0MRQ2_PINSY SCARECROW OS=Pinus sylvestris GN=SCR1 PE=... 158 1e-37
tr|Q5NDC9|Q5NDC9_CUCSA SCARECROW OS=Cucumis sativus GN=scr PE=2 ... 155 7e-37
tr|A7Q9S7|A7Q9S7_VITVI Chromosome chr8 scaffold_68, whole genome... 153 4e-36
tr|A2Q3V8|A2Q3V8_MEDTR Flagellar basal body rod protein; GRAS tr... 153 5e-36
tr|B7FA13|B7FA13_ORYSJ cDNA, clone: J100030A12, full insert sequ... 144 3e-33
tr|A9U5Y0|A9U5Y0_PHYPA Predicted protein (Fragment) OS=Physcomit... 137 3e-31
tr|Q6ULS4|Q6ULS4_MAIZE Scarecrow-like 23 (Fragment) OS=Zea mays ... 134 3e-30
tr|B6SU23|B6SU23_MAIZE Nodulation signaling pathway 2 protein OS... 134 3e-30
tr|Q7F1I1|Q7F1I1_ORYSJ SCARECROW protein-like protein OS=Oryza s... 133 4e-30
tr|Q0D5D6|Q0D5D6_ORYSJ Os07g0567700 protein OS=Oryza sativa subs... 133 4e-30
tr|A3BLA0|A3BLA0_ORYSJ Putative uncharacterized protein OS=Oryza... 133 4e-30
tr|A2YMR9|A2YMR9_ORYSI Putative uncharacterized protein OS=Oryza... 133 4e-30
tr|A9SJP4|A9SJP4_PHYPA Predicted protein (Fragment) OS=Physcomit... 132 7e-30
tr|A7R3J1|A7R3J1_VITVI Chromosome undetermined scaffold_528, who... 130 2e-29
tr|A9TUF0|A9TUF0_PHYPA Predicted protein OS=Physcomitrella paten... 129 7e-29
tr|A7Q1Q9|A7Q1Q9_VITVI Chromosome chr7 scaffold_44, whole genome... 119 8e-26
tr|A5AXM8|A5AXM8_VITVI Putative uncharacterized protein OS=Vitis... 119 1e-25
tr|B7FND6|B7FND6_MEDTR Putative uncharacterized protein OS=Medic... 111 2e-23
tr|A7P9Y5|A7P9Y5_VITVI Chromosome chr14 scaffold_9, whole genome... 97 3e-19
tr|A9SHQ0|A9SHQ0_PHYPA GRS2 GRAS-type E3 ubiquitin ligase protei... 96 1e-18
tr|A9SWX7|A9SWX7_PHYPA GRS3 GRAS-type protein OS=Physcomitrella ... 95 2e-18
tr|A9T4X6|A9T4X6_PHYPA Predicted protein (Fragment) OS=Physcomit... 93 8e-18
tr|A9SBT0|A9SBT0_PHYPA Predicted protein (Fragment) OS=Physcomit... 90 5e-17
tr|A7U4T5|A7U4T5_9TRAC DELLA protein OS=Selaginella kraussiana G... 90 5e-17
tr|A9T4X1|A9T4X1_PHYPA Predicted protein OS=Physcomitrella paten... 89 1e-16
tr|Q2R3Q8|Q2R3Q8_ORYSJ GRAS family transcription factor containi... 89 1e-16
tr|B8BKN5|B8BKN5_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A3CBL6|A3CBL6_ORYSJ Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A9LY09|A9LY09_9TRAC Putative DELLA protein OS=Selaginella moe... 88 2e-16
tr|B2BA72|B2BA72_PEA Putative gibberellin signaling DELLA protei... 87 4e-16

>tr|Q0MRQ2|Q0MRQ2_PINSY SCARECROW OS=Pinus sylvestris GN=SCR1 PE=2
SV=1
Length = 842

Score = 158 bits (399), Expect = 1e-37
Identities = 76/120 (63%), Positives = 89/120 (74%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E+KNI+AVGGPARTGE+K+D
Sbjct: 714 FLSRFVEAIHYYSALFDSLGASYPEDSHDRHLVEQQLLSREIKNILAVGGPARTGEIKFD 773

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ + GFK +SLAGNA TQATLLL MFP +GY+L EE+G LKLGWK L L TASAW
Sbjct: 774 NWRDQLKQTGFKPISLAGNAATQATLLLGMFPCQGYTLMEENGTLKLGWKGLCLLTASAW 833


>tr|Q5NDC9|Q5NDC9_CUCSA SCARECROW OS=Cucumis sativus GN=scr PE=2 SV=1
Length = 858

Score = 155 bits (393), Expect = 7e-37
Identities = 76/128 (59%), Positives = 94/128 (73%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+GEVK+
Sbjct: 715 FLGRFVEAIHYYSALFDSLGVSYGEESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQ 774

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ + +GFK +SLAGNA TQATLLL MFPS+GY+L E++G LKLGWKDL L TASAW
Sbjct: 775 NWREKLQQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAW 834

Query: 387 CWPASLHH 410
P HH
Sbjct: 835 KPP--FHH 840


>tr|A7Q9S7|A7Q9S7_VITVI Chromosome chr8 scaffold_68, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033608001
PE=4 SV=1
Length = 724

Score = 153 bits (386), Expect(2) = 4e-36
Identities = 72/120 (60%), Positives = 92/120 (76%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+G+VK++
Sbjct: 588 FLGRFVEAIHYYSALFDSLGASYGEESEQRHAVEQQLLSREIRNVLAVGGPSRSGDVKFN 647

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ + +GF+ VSLAGNA TQATLLL MFPS+GY+L E++G LKLGWKDL L TASAW
Sbjct: 648 NWREKLQQSGFRVVSLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAW 707



Score = 21.6 bits (44), Expect(2) = 4e-36
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = +2

Query: 2 QDLSHAGAF 28
QDLSHAG+F
Sbjct: 580 QDLSHAGSF 588


>tr|A2Q3V8|A2Q3V8_MEDTR Flagellar basal body rod protein; GRAS
transcription factor OS=Medicago truncatula
GN=MtrDRAFT_AC155890g4v2 PE=4 SV=1
Length = 805

Score = 153 bits (386), Expect = 5e-36
Identities = 71/120 (59%), Positives = 91/120 (75%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+G QQL S E++N++AVGGP+R+GE+K+
Sbjct: 672 FLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGEIKFH 731

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
NW+ + GF+ +SLAGNA TQA+LLL MFPSEGY+L E++G+LKLGWKDL L TASAW
Sbjct: 732 NWREKLQQCGFRGISLAGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAW 791


>tr|B7FA13|B7FA13_ORYSJ cDNA, clone: J100030A12, full insert
sequence OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 660

Score = 144 bits (362), Expect = 3e-33
Identities = 69/120 (57%), Positives = 87/120 (72%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEA+HYYSALFDS+ QQL S E++N++AVGGPARTG+VK+
Sbjct: 533 FLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG 592

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTASAW 386
+W+ + +GF+ SLAG+A QA LLL MFPS+GY+L EE+G LKLGWKDL L TASAW
Sbjct: 593 SWREKLAQSGFRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAW 652


>tr|A9U5Y0|A9U5Y0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_22273 PE=4 SV=1
Length = 364

Score = 137 bits (345), Expect = 3e-31
Identities = 72/121 (59%), Positives = 83/121 (68%), Gaps = 1/121 (0%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXXQQLFSSEMKNIVAVGGPARTGEVKYD 206
F+ RFVEALHYYSALFDS+G QQL S E+KNI+A GGPARTGE K+D
Sbjct: 245 FLSRFVEALHYYSALFDSLGASYKADSPERHMVEQQLLSCEIKNILAFGGPARTGEAKFD 304

Query: 207 NWKTVMGSAGFKQVSLAGNATTQATLLL-NMFPSEGYSLSEEDGVLKLGWKDLSLYTASA 383
W+ +G FK VSL+G A QA LLL +FP EGY+L E G LKLGWKDL L+TASA
Sbjct: 305 QWRDELGKR-FKPVSLSGKAAHQAALLLQGLFPCEGYTLLEHRGTLKLGWKDLYLFTASA 363

Query: 384 W 386
W
Sbjct: 364 W 364


>tr|Q6ULS4|Q6ULS4_MAIZE Scarecrow-like 23 (Fragment) OS=Zea mays
GN=scl23 PE=2 SV=1
Length = 313

Score = 134 bits (336), Expect = 3e-30
Identities = 69/123 (56%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXX---QQLFSSEMKNIVAVGGPARTGEV 197
F+ RFVEALHYYSALFD++G +QL +E++NIVAVGGP RTGEV
Sbjct: 178 FLGRFVEALHYYSALFDALGDGAGAAEEESAERYAVERQLLGAEIRNIVAVGGPKRTGEV 237

Query: 198 KYDNWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTA 377
+ + W + AGF+ VSLAG+ QA LLL M+P +GY+L EED LKLGWKDLSL TA
Sbjct: 238 RVERWSHELRHAGFRPVSLAGSPAAQARLLLGMYPWKGYTLVEEDACLKLGWKDLSLLTA 297

Query: 378 SAW 386
SAW
Sbjct: 298 SAW 300


>tr|B6SU23|B6SU23_MAIZE Nodulation signaling pathway 2 protein
OS=Zea mays PE=2 SV=1
Length = 452

Score = 134 bits (336), Expect = 3e-30
Identities = 69/123 (56%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXX---QQLFSSEMKNIVAVGGPARTGEV 197
F+ RFVEALHYYSALFD++G +QL +E++NIVAVGGP RTGEV
Sbjct: 317 FLGRFVEALHYYSALFDALGDGAGAAEEESAERYAVERQLLGAEIRNIVAVGGPKRTGEV 376

Query: 198 KYDNWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTA 377
+ + W + AGF+ VSLAG+ QA LLL M+P +GY+L EED LKLGWKDLSL TA
Sbjct: 377 RVERWSHELQHAGFRPVSLAGSPAAQARLLLGMYPWKGYTLVEEDACLKLGWKDLSLLTA 436

Query: 378 SAW 386
SAW
Sbjct: 437 SAW 439


>tr|Q7F1I1|Q7F1I1_ORYSJ SCARECROW protein-like protein OS=Oryza
sativa subsp. japonica GN=OJ1092_A07.120 PE=4 SV=1
Length = 306

Score = 133 bits (335), Expect = 4e-30
Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXX---QQLFSSEMKNIVAVGGPARTGEV 197
F+ RFVEALHYYSALFD++G +QL +E++NIVAVGGP RTGEV
Sbjct: 160 FLGRFVEALHYYSALFDALGDGAGAAEEEAAERHAVERQLLGAEIRNIVAVGGPKRTGEV 219

Query: 198 KYDNWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTA 377
+ + W + AGF+ V+LAG+ QA LLL M+P +GY+L EEDG LKLGWKDLSL TA
Sbjct: 220 RVERWGDELRRAGFRPVTLAGSPAAQARLLLGMYPWKGYTLVEEDGCLKLGWKDLSLLTA 279

Query: 378 SAW 386
S+W
Sbjct: 280 SSW 282


>tr|Q0D5D6|Q0D5D6_ORYSJ Os07g0567700 protein OS=Oryza sativa subsp.
japonica GN=Os07g0567700 PE=4 SV=1
Length = 457

Score = 133 bits (335), Expect = 4e-30
Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
Frame = +3

Query: 27 FVDRFVEALHYYSALFDSVGXXXXXXXXXXXXXX---QQLFSSEMKNIVAVGGPARTGEV 197
F+ RFVEALHYYSALFD++G +QL +E++NIVAVGGP RTGEV
Sbjct: 311 FLGRFVEALHYYSALFDALGDGAGAAEEEAAERHAVERQLLGAEIRNIVAVGGPKRTGEV 370

Query: 198 KYDNWKTVMGSAGFKQVSLAGNATTQATLLLNMFPSEGYSLSEEDGVLKLGWKDLSLYTA 377
+ + W + AGF+ V+LAG+ QA LLL M+P +GY+L EEDG LKLGWKDLSL TA
Sbjct: 371 RVERWGDELRRAGFRPVTLAGSPAAQARLLLGMYPWKGYTLVEEDGCLKLGWKDLSLLTA 430

Query: 378 SAW 386
S+W
Sbjct: 431 SSW 433