BP915763
Clone id YMU001_000076_E08
Library
Length 521
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCTGGTGCTGCCTCATTTCCAAGGTAGGTTGTTATGTCACGCACTTGCTTCCATATCTG
AAAAGGATTATGGCTTTGAGCCTCACCATAGTTTGAAAGCAAGTGTCTTTCCTTTGCACC
ACCCATACATATCTTATTATGGTTATCTTGTGTGATTGTTGGGTTCTTGTGGTACCTTGA
GAGGGTTACTACACCGGAGTGAAGGACCACCAATGACAAGGTTGTTTCAAGCACTCAAAT
GCACTCCTCTTGCTGAGACTCTAGCTCCATGTTCCATACATAATTTATGTGGAGCATTAG
AAACTTGTCCAAAATTCAAAGTCTCAAATGCAAGGAGCAGACATGTACTTGATTAAGGGG
AATTGAAAGAATGGGATGCCAATTTGGATCCTCCTCTGTGTGAGATGGTGGCTTGCTTTG
TCACAAGTCATGATCCATTGAACCATACATGCCCCCCGCATGCCTTTTGTGATTCTTGTT
CGAGATCCTAGCACCTACTTGCTTATGTAATTTTTCCCTTC
■■Homology search results ■■ -
sp_hit_id P00207
Definition sp|P00207|FER1_RHOPA Ferredoxin-1 OS=Rhodopseudomonas palustris
Align length 59
Score (bit) 33.5
E-value 0.62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915763|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E08.
(521 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P00207|FER1_RHOPA Ferredoxin-1 OS=Rhodopseudomonas palustris ... 33 0.62
sp|P52638|VGLG_BDV Envelope protein p57 OS=Borna disease virus G... 31 3.1
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsi... 30 5.3
sp|Q8XCZ0|RNZ_ECO57 Ribonuclease Z OS=Escherichia coli O157:H7 G... 30 9.0

>sp|P00207|FER1_RHOPA Ferredoxin-1 OS=Rhodopseudomonas palustris
GN=fer1 PE=1 SV=2
Length = 63

Score = 33.5 bits (75), Expect = 0.62
Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)
Frame = +3

Query: 285 LCGALE-TCPKFKVSNARSRHVLD*GELKEWDANLDPPLCEMVACFVTSHDPLNHTCPP 458
+CGA E CP +S R +V+D + E + D P C V P+++TC P
Sbjct: 11 VCGACEFECPNAAISMKRGTYVIDATKCTECEGQFDKPQCVSVC-------PVDNTCVP 62


>sp|P52638|VGLG_BDV Envelope protein p57 OS=Borna disease virus GN=G
PE=1 SV=1
Length = 503

Score = 31.2 bits (69), Expect = 3.1
Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 2/107 (1%)
Frame = +3

Query: 171 GTLRGLLHRS--EGPPMTRLFQALKCTPLAETLAPCSIHNLCGALETCPKFKVSNARSRH 344
GT++G L+ S E P F C+ + + CSI N+ A++T P F +
Sbjct: 102 GTVKGCLNNSAPEDPFECNWFYC--CSAITTEICRCSITNVTVAVQTFPPFMYCSFADCS 159

Query: 345 VLD*GELKEWDANLDPPLCEMVACFVTSHDPLNHTCPPHAFCDSCSR 485
+ EL+ A L ++ + +N T C+S S+
Sbjct: 160 TVSQQELESGKAMLSDGSTLTYTPYILQSEVVNKTLNGTILCNSSSK 206


>sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis
thaliana GN=GAE6 PE=1 SV=1
Length = 460

Score = 30.4 bits (67), Expect = 5.3
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = +3

Query: 39 HALASISEKDYGFEPHHSLKASVFPLHHPYISYYG 143
HA S++ KD+G++P L A + Y+ YYG
Sbjct: 410 HANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYG 444


>sp|Q8XCZ0|RNZ_ECO57 Ribonuclease Z OS=Escherichia coli O157:H7
GN=rnz PE=3 SV=2
Length = 305

Score = 29.6 bits (65), Expect = 9.0
Identities = 16/48 (33%), Positives = 24/48 (50%)
Frame = +3

Query: 96 KASVFPLHHPYISYYGYLV*LLGSCGTLRGLLHRSEGPPMTRLFQALK 239
K + +P+ HP + YGY + G L ++ G P + LFQ LK
Sbjct: 133 KVTAYPMEHP-LECYGYRIEEHDKPGALNAQALKAAGVPPSPLFQELK 179


tr_hit_id Q54JK2
Definition tr|Q54JK2|Q54JK2_DICDI Putative uncharacterized protein OS=Dictyostelium discoideum
Align length 69
Score (bit) 35.0
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915763|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E08.
(521 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q54JK2|Q54JK2_DICDI Putative uncharacterized protein OS=Dicty... 35 2.2
tr|A3R6V2|A3R6V2_PLAFA Erythrocyte membrane protein 1 OS=Plasmod... 35 2.2
tr|Q07HX2|Q07HX2_RHOP5 4Fe-4S ferredoxin, iron-sulfur binding do... 34 5.0
tr|Q2J1J2|Q2J1J2_RHOP2 4Fe-4S ferredoxin, iron-sulfur binding OS... 33 6.5
tr|B3QB58|B3QB58_RHOPT 4Fe-4S ferredoxin iron-sulfur binding dom... 33 6.5

>tr|Q54JK2|Q54JK2_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0187727 PE=4 SV=1
Length = 1405

Score = 35.0 bits (79), Expect = 2.2
Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 16/69 (23%)
Frame = -3

Query: 186 TLSRYHKNPTITQDNHNKI------------CMGGAKERHLLSNYGEAQSHNP----FQI 55
TL +Y K+ T+TQD+ NKI C +HLLSNY +++S N +
Sbjct: 799 TLGKYIKS-TLTQDSINKIKSLIDSEKQVHVCFSNLFLKHLLSNYLQSKSSNDSIQFIEY 857

Query: 54 WKQVRDITT 28
+K+++DI T
Sbjct: 858 FKKIKDIDT 866


>tr|A3R6V2|A3R6V2_PLAFA Erythrocyte membrane protein 1 OS=Plasmodium
falciparum GN=IT4_var7 PE=4 SV=1
Length = 3459

Score = 35.0 bits (79), Expect = 2.2
Identities = 21/80 (26%), Positives = 39/80 (48%)
Frame = -3

Query: 501 QVGARISNKNHKRHAGGMYGSMDHDL*QSKPPSHTEEDPNWHPILSIPLNQVHVCSLHLR 322
++G SN++ KR G YG +H K SH E + + +P + H+C+ +L
Sbjct: 794 KIGKNHSNRDPKRSDGPCYGKNEHRFEIGKVWSHVNEKKTTYTDVYLPQRREHMCTSYL- 852

Query: 321 L*ILDKFLMLHINYVWNMEL 262
++L +I+ + ME+
Sbjct: 853 -----EYLQTNISPLNGMEI 867


>tr|Q07HX2|Q07HX2_RHOP5 4Fe-4S ferredoxin, iron-sulfur binding
domain protein OS=Rhodopseudomonas palustris (strain
BisA53) GN=RPE_4542 PE=4 SV=1
Length = 64

Score = 33.9 bits (76), Expect = 5.0
Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
Frame = +3

Query: 282 NLCGALE-TCPKFKVSNARSRHVLD*GELKEWDANLDPPLCEMVACFVTSHDPLNHTCPP 458
++CGA E CP +S R +V+D + E + D P C +V P+ TC P
Sbjct: 11 SVCGACEFECPNAAISLKREMYVIDASKCTECEGQFDKPQCAVVC-------PVEKTCIP 63


>tr|Q2J1J2|Q2J1J2_RHOP2 4Fe-4S ferredoxin, iron-sulfur binding
OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_0958
PE=4 SV=1
Length = 64

Score = 33.5 bits (75), Expect = 6.5
Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
Frame = +3

Query: 285 LCGALE-TCPKFKVSNARSRHVLD*GELKEWDANLDPPLCEMVACFVTSHDPLNHTCPP 458
+CGA E CP +S R +V+D + E + + D P C V P+++TC P
Sbjct: 12 VCGACEFECPNAAISMKRGTYVIDAVKCTECEGHFDKPQCVAVC-------PVDNTCVP 63


>tr|B3QB58|B3QB58_RHOPT 4Fe-4S ferredoxin iron-sulfur binding domain
protein OS=Rhodopseudomonas palustris (strain TIE-1)
GN=Rpal_5112 PE=4 SV=1
Length = 64

Score = 33.5 bits (75), Expect = 6.5
Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)
Frame = +3

Query: 285 LCGALE-TCPKFKVSNARSRHVLD*GELKEWDANLDPPLCEMVACFVTSHDPLNHTCPP 458
+CGA E CP +S R +V+D + E + D P C V P+++TC P
Sbjct: 12 VCGACEFECPNAAISMKRGTYVIDATKCTECEGQFDKPQCVSVC-------PVDNTCVP 63