BP915767
Clone id YMU001_000076_E12
Library
Length 413
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGAACACAAATTTGCATTTTAATTTATCCATGGTGTATGGAGACAGGATGCTTATTTACA
CCCTTTCCTTTCATAGACATATCTGGCCTTTGCATGTCATATGATATTTCTATTTCTATG
TCTTGATATGGTACAAGCGGATGATATACAACACTGGAAGGGCCTGGACATAATCAGCAG
ATAAATGGTAAATGTGGTCAGTTTCTTGAACATCAAAGAGGGGTCATCTCGGGCATGCTC
CTCCCGCTGCCATCTTTCATCTGTTGAATGTGCATCCCAAGCCCTTGTTGTCGATAACAC
TACAATACAAAGAGAATGTTAAAGGCCCTGCTCCTGACATGCACTCCCTTACAAAAGCCT
TGCTTGCCTCATCATCCTATCAAGAAAATAAGATGCATGCCTCGTTGCAAACA
■■Homology search results ■■ -
sp_hit_id O70244
Definition sp|O70244|CUBN_RAT Cubilin OS=Rattus norvegicus
Align length 42
Score (bit) 29.3
E-value 6.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915767|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E12.
(413 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O70244|CUBN_RAT Cubilin OS=Rattus norvegicus GN=Cubn PE=1 SV=2 29 6.5
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1... 29 8.4
sp|Q9H6E5|TUT1_HUMAN U6 snRNA-specific terminal uridylyltransfer... 29 8.4

>sp|O70244|CUBN_RAT Cubilin OS=Rattus norvegicus GN=Cubn PE=1 SV=2
Length = 3623

Score = 29.3 bits (64), Expect = 6.5
Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
Frame = +1

Query: 148 TTLEGPGHNQQINGKCGQFLEHQRGVISGMLLP---LPSFIC 264
T++ G G N + CG +L RGVI+ P LP+ C
Sbjct: 2077 TSVAGTGFNASFHKSCGGYLHADRGVITSPKYPDTYLPNLNC 2118


>sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1
OS=Homo sapiens GN=ZNFX1 PE=1 SV=2
Length = 1918

Score = 28.9 bits (63), Expect = 8.4
Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 11/92 (11%)
Frame = +1

Query: 166 GHNQQINGKCGQFLEHQRGVISGMLLPLPSFIC*MCI------PSPC--C---R*HYNTK 312
GH+Q + KCG H G++ G LL + C + P C C R H +
Sbjct: 1409 GHSQPV--KCG----HVEGLLYGGLLVKCTTKCGTILDCGHPCPGSCHSCFEGRFHERCQ 1462

Query: 313 RMLKALLLTCTPLQKPCLPHHPIKKIRCMPRC 408
+ K LL+ Q+PC+ P + C RC
Sbjct: 1463 QPCKRLLICSHKCQEPCIGECPPCQRTCQNRC 1494


>sp|Q9H6E5|TUT1_HUMAN U6 snRNA-specific terminal uridylyltransferase
1 OS=Homo sapiens GN=TUT1 PE=1 SV=2
Length = 874

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/35 (40%), Positives = 17/35 (48%)
Frame = +3

Query: 258 HLLNVHPKPLLSITLQYKENVKGPAPDMHSLTKAL 362
H L V P+ ++ KG APD H L KAL
Sbjct: 119 HRLRVRPREQKEFQSPASKSPKGAAPDSHQLAKAL 153


tr_hit_id A7RWM8
Definition tr|A7RWM8|A7RWM8_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis
Align length 50
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915767|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_E12.
(413 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7RWM8|A7RWM8_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 4.2
tr|B4JY06|B4JY06_DROGR GH14114 OS=Drosophila grimshawi GN=GH1411... 33 9.3
tr|B8MQ47|B8MQ47_9EURO Gamma-tubulin complex component GCP4, put... 33 9.3
tr|Q8TUK5|Q8TUK5_METAC Predicted protein OS=Methanosarcina aceti... 33 9.3

>tr|A7RWM8|A7RWM8_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g23136 PE=4 SV=1
Length = 319

Score = 33.9 bits (76), Expect = 4.2
Identities = 16/50 (32%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIY--TLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY + +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 62 IYWHRHVIYLHRRVIYCHVIYWHRHVIYWHSHVI-YWHRHVIYWHRHVIY 110



Score = 33.9 bits (76), Expect = 4.2
Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIYTLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 88 IYWHSHVIYWHRHVIY---WHRHVIYWHRHVI-YWHRHVIYWHRHVIY 131



Score = 33.9 bits (76), Expect = 4.2
Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIYTLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 95 IYWHRHVIYWHRHVIY---WHRHVIYWHRHVI-YWHRHVIYWHRHVIY 138



Score = 33.9 bits (76), Expect = 4.2
Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIYTLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 102 IYWHRHVIYWHRHVIY---WHRHVIYWHRHVI-YWHRHVIYWHRHVIY 145



Score = 33.9 bits (76), Expect = 4.2
Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIYTLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 109 IYWHRHVIYWHRHVIY---WHRHVIYWHRHVI-YWHRHVIYWHRHVIY 152



Score = 33.9 bits (76), Expect = 4.2
Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 2/48 (4%)
Frame = +3

Query: 12 LHFNLSMVYGDRMLIYTLSFHRHI--WPLHVI*YFYFYVLIWYKRMIY 149
++++ ++Y R +IY +HRH+ W HVI Y++ +V+ W++ +IY
Sbjct: 116 IYWHRHVIYWHRHVIY---WHRHVIYWHRHVI-YWHRHVIYWHRHVIY 159


>tr|B4JY06|B4JY06_DROGR GH14114 OS=Drosophila grimshawi GN=GH14114
PE=4 SV=1
Length = 145

Score = 32.7 bits (73), Expect = 9.3
Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
Frame = -2

Query: 319 TFSLYCSVIDNKGLGCTFNR*KM-AAGGACPR*PLFDVQETD 197
T++L CS++D G+GC ++ A GG+ PL DV+E D
Sbjct: 57 TWTLICSLVDRIGIGCALLGDRLIAVGGSNGNSPLNDVEEYD 98


>tr|B8MQ47|B8MQ47_9EURO Gamma-tubulin complex component GCP4,
putative OS=Talaromyces stipitatus ATCC 10500
GN=TSTA_055730 PE=4 SV=1
Length = 807

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/50 (40%), Positives = 30/50 (60%)
Frame = +3

Query: 264 LNVHPKPLLSITLQYKENVKGPAPDMHSLTKALLASSSYQENKMHASLQT 413
L+ P PLL + L+ GP P + KALLAS + + +++HASL+T
Sbjct: 9 LSGQPSPLLDLELEPNGASSGPFPLLSPPEKALLASLA-RLSRLHASLRT 57


>tr|Q8TUK5|Q8TUK5_METAC Predicted protein OS=Methanosarcina
acetivorans GN=MA_0062 PE=4 SV=1
Length = 141

Score = 32.7 bits (73), Expect = 9.3
Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
Frame = +2

Query: 125 DMVQADDIQHWKGLDIISR*MVNVVSFL--NIKEGSSRACSSRCHLSSVECASQALVVDN 298
+++ D++ WK L + R + S + N+K S+ C++ L S+E S+ +++D
Sbjct: 31 NLIVGQDVKFWKNLTVSGRLELGKGSIIQGNVKARSALICAAAKILGSIETVSELVLLDG 90

Query: 299 TTI 307
T +
Sbjct: 91 TWV 93