BP915788
Clone id YMU001_000076_G11
Library
Length 560
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCTTTGATCTCTTATTGTCTGACGCTCGTAGAGAAGGGCATTTTGATTGTGGAATTGTTG
ATATCAAAGCTCATTCTATAGAGCTGCAAGAGAGACCAAAGACCGTACATGTGGATCCTA
TGTCTGGGGCATCAACCACTCTTTCTATATTGAAAGTTGATCGAGGGCTAACTTGGGAGG
CTGCCATTAAGATCTTAGAACAAAATGATGCTGAGAAGAGACCGAACAACGGTTTCTATG
AATCCAAGCGAGAGTGGCTAGGCAGAGCCCACTATTTGCTTACAATATACTGGCCCAAGA
GCATGTCTGAAGTCTACCGAATTTTTCGACCAGCCGATGGAGAAGCCTTGAGGGAAATGC
CAGAAGATGAGCTTCTTAGTAAATATTCGAAACTAACCTCATTGGAGATGGCTGAAAAAA
AGTAGCAAGACGAGTACAACATAACCGATGAACAGTGTATGCATGGGCCAAAGTGCAAAG
TTGGGTCAGCTTGTACAGTTGGTAGAAGAGTTCAAGAAATGTTTATCCTAGGTGGACTTA
TCCTTCCAGTCTGGGGCACA
■■Homology search results ■■ -
sp_hit_id Q7TNB8
Definition sp|Q7TNB8|SBNO2_MOUSE Protein strawberry notch homolog 2 OS=Mus musculus
Align length 194
Score (bit) 73.9
E-value 5.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915788|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_G11.
(560 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7TNB8|SBNO2_MOUSE Protein strawberry notch homolog 2 OS=Mus ... 74 5e-13
sp|Q689Z5|SBNO1_MOUSE Protein strawberry notch homolog 1 OS=Mus ... 67 5e-11
sp|A3KN83|SBNO1_HUMAN Protein strawberry notch homolog 1 OS=Homo... 67 5e-11
sp|Q5BJL5|SBNO1_RAT Protein strawberry notch homolog 1 OS=Rattus... 66 1e-10
sp|Q9Y2G9|SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo... 64 4e-10
sp|A0JND4|SBNO2_BOVIN Protein strawberry notch homolog 2 OS=Bos ... 62 1e-09
sp|A8JUV0|SBNO_DROME Protein strawberry notch OS=Drosophila mela... 57 8e-08
sp|Q5F371|SBNO1_CHICK Protein strawberry notch homolog 1 OS=Gall... 39 0.023
sp|Q8TCZ9|PKHD1_HUMAN Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 ... 30 6.2
sp|Q6P6Y1|K1468_DANRE LisH domain and HEAT repeat-containing pro... 30 8.1

>sp|Q7TNB8|SBNO2_MOUSE Protein strawberry notch homolog 2 OS=Mus
musculus GN=Sbno2 PE=2 SV=1
Length = 1349

Score = 73.9 bits (180), Expect = 5e-13
Identities = 53/194 (27%), Positives = 93/194 (47%), Gaps = 9/194 (4%)
Frame = +3

Query: 3 FDLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHV---DPMSGASTTLSILKVDRGLT 173
FD L+ ++EG +D GI+D+ E+ E + V + P G + VDRG+
Sbjct: 985 FDHLIEIDKKEGRYDMGILDLAPGINEIHEESQQVFLAPGHPQDGQVVFYKQISVDRGMK 1044

Query: 174 WEAAIKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALR 353
WE A L ++ K P +GFY S + R + + ++ E + +++P G +
Sbjct: 1045 WEEA---LTRSLELKGPYDGFYLSYKV---RGSKMSCLLAEQNRGEYFTVYKPNIGRQSQ 1098

Query: 354 EMPEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMH---GPKCKV---GSACTVGRRVQ 515
D L K+ ++T +E A + + Y ++ E C H +C++ G C G R++
Sbjct: 1099 LETLDSLCRKFHRVT-VEEAREPWESSYALSLEHCSHTTWNQRCRLTQEGKCCAQGLRLR 1157

Query: 516 EMFILGGLILPVWG 557
++L G +L VWG
Sbjct: 1158 HHYMLCGALLRVWG 1171


>sp|Q689Z5|SBNO1_MOUSE Protein strawberry notch homolog 1 OS=Mus
musculus GN=Sbno1 PE=2 SV=2
Length = 1390

Score = 67.4 bits (163), Expect = 5e-11
Identities = 51/191 (26%), Positives = 95/191 (49%), Gaps = 10/191 (5%)
Frame = +3

Query: 12 LLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTT----LSILKVDRGLTWE 179
++ +A++ G +D GI+D+ + ++++ + P G ST+ L + V+RG++WE
Sbjct: 1129 VVQNAKKSGRYDMGILDLGSGDEKVRKSDVKKFLTP--GYSTSGHVELYTISVERGMSWE 1186

Query: 180 AAIKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
A KI + P++GFY S + + +L + +++ I+RP G+ L+
Sbjct: 1187 EATKIWAELTG---PDDGFYLSLQIRNNKKTAIL-VKEVNPKKKLFLIYRPNTGKQLKLE 1242

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHG------PKCKVGSACTVGRRVQEM 521
+L KY K+ S + A D+YN + + C H K +G C +G R +
Sbjct: 1243 IYADLKKKYKKVVS-DDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTY 1301

Query: 522 FILGGLILPVW 554
++L G +L VW
Sbjct: 1302 YVLCGSVLSVW 1312


>sp|A3KN83|SBNO1_HUMAN Protein strawberry notch homolog 1 OS=Homo
sapiens GN=SBNO1 PE=1 SV=1
Length = 1393

Score = 67.4 bits (163), Expect = 5e-11
Identities = 50/191 (26%), Positives = 95/191 (49%), Gaps = 10/191 (5%)
Frame = +3

Query: 12 LLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTT----LSILKVDRGLTWE 179
++ +A++ G +D GI+D+ + ++++ + P G ST+ L + V+RG++WE
Sbjct: 1132 VVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTP--GYSTSGHVELYTISVERGMSWE 1189

Query: 180 AAIKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
A KI + P++GFY S + + +L + +++ ++RP G+ L+
Sbjct: 1190 EATKIWAELTG---PDDGFYLSLQIRNNKKTAIL-VKEVNPKKKLFLVYRPNTGKQLKLE 1245

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHG------PKCKVGSACTVGRRVQEM 521
+L KY K+ S + A D+YN + + C H K +G C +G R +
Sbjct: 1246 IYADLKKKYKKVVS-DDALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTY 1304

Query: 522 FILGGLILPVW 554
++L G +L VW
Sbjct: 1305 YVLCGSVLSVW 1315


>sp|Q5BJL5|SBNO1_RAT Protein strawberry notch homolog 1 OS=Rattus
norvegicus GN=Sbno1 PE=2 SV=2
Length = 1269

Score = 66.2 bits (160), Expect = 1e-10
Identities = 50/191 (26%), Positives = 95/191 (49%), Gaps = 10/191 (5%)
Frame = +3

Query: 12 LLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTT----LSILKVDRGLTWE 179
++ +A++ G +D GI+D+ + ++++ + P G ST+ L + V+RG++W+
Sbjct: 1008 VVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTP--GYSTSGHVELYTISVERGMSWD 1065

Query: 180 AAIKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
A KI + P++GFY S + + +L + +++ I+RP G+ L+
Sbjct: 1066 EATKIWAELTG---PDDGFYLSLQIRNNKKTAIL-VKEVNPKKKLFLIYRPNTGKQLKLE 1121

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHG------PKCKVGSACTVGRRVQEM 521
+L KY K+ S + A D+YN + + C H K +G C +G R +
Sbjct: 1122 IYADLKKKYKKVVS-DDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTY 1180

Query: 522 FILGGLILPVW 554
++L G +L VW
Sbjct: 1181 YVLCGSVLSVW 1191


>sp|Q9Y2G9|SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo
sapiens GN=SBNO2 PE=2 SV=3
Length = 1366

Score = 64.3 bits (155), Expect = 4e-10
Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 8/193 (4%)
Frame = +3

Query: 3 FDLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDP--MSGASTTLSILKVDRGLTW 176
FD L+ +REG +D GI+D+ E+ E + V + P + VDRGL W
Sbjct: 991 FDHLIEMDKREGKYDMGILDLAPGIEEIYEESQQVFLAPGHPQDGQVVFYKISVDRGLKW 1050

Query: 177 EAAIKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALRE 356
E A ++ A P +GFY S + + LL ++ + + +++P G +
Sbjct: 1051 EDA---FAKSLALTGPYDGFYLSYKVRGNKPSCLLA---EQNRGQFFTVYKPNIGRQSQL 1104

Query: 357 MPEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGP---KCKV---GSACTVGRRVQE 518
D L K+ ++T+ E A++ + Y ++ C H C++ G C G R++
Sbjct: 1105 EALDSLRRKFHRVTA-EEAKEPWESGYALSLTHCSHSAWNRHCRLAQEGKDCLQGLRLRH 1163

Query: 519 MFILGGLILPVWG 557
++L G +L VWG
Sbjct: 1164 HYMLCGALLRVWG 1176


>sp|A0JND4|SBNO2_BOVIN Protein strawberry notch homolog 2 OS=Bos
taurus GN=SBNO2 PE=2 SV=1
Length = 1374

Score = 62.4 bits (150), Expect = 1e-09
Identities = 51/194 (26%), Positives = 90/194 (46%), Gaps = 9/194 (4%)
Frame = +3

Query: 3 FDLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDP--MSGASTTLSILKVDRGLTW 176
FD L++ +REG +D GI+D+ E+ E + V + P + VDRGL W
Sbjct: 998 FDHLIAADKREGKYDMGILDLAPGIDEIYEESQQVFLAPGHPQDGQVVFYKISVDRGLKW 1057

Query: 177 EAA-IKILEQNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALR 353
E A + LE ++GFY S + + LL ++ +++ +++P G +
Sbjct: 1058 EEAYARSLELTGT----HDGFYLSYKVRGNKPSCLLA---QQNRGKLFTVYKPNIGRQSQ 1110

Query: 354 EMPEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMH---GPKCKV---GSACTVGRRVQ 515
D L ++ ++T+ E A + + Y + C H C++ G C G R++
Sbjct: 1111 LESLDSLSRRFRRVTA-EEAREPWESSYTFSLTHCSHTTWNRHCRLVQEGKDCAQGLRLR 1169

Query: 516 EMFILGGLILPVWG 557
++L G +L VWG
Sbjct: 1170 HHYMLCGALLRVWG 1183


>sp|A8JUV0|SBNO_DROME Protein strawberry notch OS=Drosophila
melanogaster GN=sno PE=1 SV=1
Length = 1833

Score = 56.6 bits (135), Expect = 8e-08
Identities = 56/213 (26%), Positives = 90/213 (42%), Gaps = 31/213 (14%)
Frame = +3

Query: 12 LLSDARREGHFDCGIVDIKA--HSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
++ A+R G FD GI+D+ A ++ + V A T + ++V+RG+ W+ A
Sbjct: 1569 IIQQAKRGGRFDLGILDLGAAGENVTRVRLIRFVRKHATGVAPTEMHTVRVERGMIWQEA 1628

Query: 186 IKILEQNDAEKRPNNGFYESKR-EWLGRAHYLLTIYWPKSMSE----------------- 311
I E N GFY S + R ++ I ++ S
Sbjct: 1629 IDKYADLFNE---NEGFYLSHQLRNQKRTAIMVVILESRNSSSTSSTTDLDSGSKKKKTH 1685

Query: 312 -----VYRIFRPADGEALREMPEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHG--- 467
+ +I+RP G +R EL KY K+ S E AE ++Y+ + C H
Sbjct: 1686 SKKEIMCQIYRPNTGLQVRHESLFELEKKYRKVAS-EEAEPHWTEQYDASVNTCSHAYWN 1744

Query: 468 PKCK---VGSACTVGRRVQEMFILGGLILPVWG 557
C+ +G+ C VG R + +L G +L VWG
Sbjct: 1745 GNCRNVSLGNDCEVGLRQRLYHVLAGSVLSVWG 1777


>sp|Q5F371|SBNO1_CHICK Protein strawberry notch homolog 1 OS=Gallus
gallus GN=SBNO1 PE=2 SV=1
Length = 1239

Score = 38.5 bits (88), Expect = 0.023
Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 4/82 (4%)
Frame = +3

Query: 12 LLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTT----LSILKVDRGLTWE 179
++ +A++ G +D GI+D+ + ++++ + P G ST+ L + V+RG++W+
Sbjct: 1128 VIQNAKKNGRYDMGILDLGSGDEKVRKADVKKFLTP--GYSTSGHVELYTISVERGMSWD 1185

Query: 180 AAIKILEQNDAEKRPNNGFYES 245
A KI + + P++GFY S
Sbjct: 1186 EATKIWAE---QTGPDDGFYLS 1204


>sp|Q8TCZ9|PKHD1_HUMAN Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1
Length = 4074

Score = 30.4 bits (67), Expect = 6.2
Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 6/63 (9%)
Frame = +3

Query: 9 LLLSDARRE------GHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGL 170
LLL+ RR G F C I+ + H+I Q ++ DP+ GAS +L++ + GL
Sbjct: 1412 LLLNSRRRSVRVDLSGPFTCVILSLGDHTILCQV---SLEGDPLPGASFSLNVTVLVNGL 1468

Query: 171 TWE 179
T E
Sbjct: 1469 TSE 1471


>sp|Q6P6Y1|K1468_DANRE LisH domain and HEAT repeat-containing
protein KIAA1468 homolog OS=Danio rerio GN=zgc:66014
PE=2 SV=1
Length = 1189

Score = 30.0 bits (66), Expect = 8.1
Identities = 16/59 (27%), Positives = 29/59 (49%)
Frame = +3

Query: 297 KSMSEVYRIFRPADGEALREMPEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPK 473
KS E RP + AL + + LL KLTS+ +++ ++ + D+ ++ PK
Sbjct: 216 KSSPETQEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPK 274


tr_hit_id A7QML6
Definition tr|A7QML6|A7QML6_VITVI Chromosome chr19 scaffold_126, whole genome shotgun sequence OS=Vitis vinifera
Align length 187
Score (bit) 223.0
E-value 5.0e-57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915788|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_G11.
(560 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QML6|A7QML6_VITVI Chromosome chr19 scaffold_126, whole geno... 223 5e-57
tr|Q7XPM3|Q7XPM3_ORYSJ OSJNBa0085I10.3 protein OS=Oryza sativa s... 218 1e-55
tr|Q25AI3|Q25AI3_ORYSA H0702G05.10 protein OS=Oryza sativa GN=H0... 218 1e-55
tr|Q0JA99|Q0JA99_ORYSJ Os04g0609700 protein (Fragment) OS=Oryza ... 218 1e-55
tr|B8ATX2|B8ATX2_ORYSI Putative uncharacterized protein OS=Oryza... 218 1e-55
tr|B8BBY7|B8BBY7_ORYSI Putative uncharacterized protein OS=Oryza... 214 3e-54
tr|Q7F1V5|Q7F1V5_ORYSJ Putative sno protein OS=Oryza sativa subs... 214 3e-54
tr|Q0WQ12|Q0WQ12_ARATH Putative uncharacterized protein At1g7935... 214 3e-54
tr|Q0J779|Q0J779_ORYSJ Os08g0223700 protein OS=Oryza sativa subs... 214 3e-54
tr|O64516|O64516_ARATH YUP8H12R.3 protein OS=Arabidopsis thalian... 214 3e-54
tr|A3BQS1|A3BQS1_ORYSJ Putative uncharacterized protein OS=Oryza... 214 3e-54
tr|Q00UP9|Q00UP9_OSTTA Nuclear helicase MOP-3/SNO (DEAD-box supe... 116 9e-25
tr|A4S803|A4S803_OSTLU Predicted protein (Fragment) OS=Ostreococ... 110 4e-23
tr|B3RSN6|B3RSN6_TRIAD Putative uncharacterized protein OS=Trich... 108 3e-22
tr|A7RYE7|A7RYE7_NEMVE Predicted protein OS=Nematostella vectens... 107 6e-22
tr|A3AX96|A3AX96_ORYSJ Putative uncharacterized protein OS=Oryza... 86 4e-16
tr|B4P0W7|B4P0W7_DROYA GE19053 OS=Drosophila yakuba GN=GE19053 P... 77 8e-13
tr|B3N5M2|B3N5M2_DROER GG25134 OS=Drosophila erecta GN=GG25134 P... 75 2e-12
tr|B6MGJ1|B6MGJ1_BRAFL Putative uncharacterized protein OS=Branc... 74 4e-12
tr|B6LJV5|B6LJV5_BRAFL Putative uncharacterized protein OS=Branc... 74 4e-12
tr|Q9V453|Q9V453_DROME CG3491 OS=Drosophila melanogaster GN=CG34... 73 9e-12
tr|Q8MSP6|Q8MSP6_DROME AT03687p OS=Drosophila melanogaster GN=BG... 73 9e-12
tr|B4NRH7|B4NRH7_DROWI GK23494 (Fragment) OS=Drosophila willisto... 72 3e-11
tr|B4HXK8|B4HXK8_DROSE GM15829 OS=Drosophila sechellia GN=GM1582... 71 3e-11
tr|B6NK51|B6NK51_BRAFL Putative uncharacterized protein (Fragmen... 71 5e-11
tr|B4L8X6|B4L8X6_DROMO GI16658 OS=Drosophila mojavensis GN=GI166... 71 5e-11
tr|B4J2E0|B4J2E0_DROGR GH16004 OS=Drosophila grimshawi GN=GH1600... 71 5e-11
tr|Q17PW5|Q17PW5_AEDAE Putative uncharacterized protein OS=Aedes... 70 1e-10
tr|B4LCV3|B4LCV3_DROVI GJ12910 OS=Drosophila virilis GN=GJ12910 ... 70 1e-10
tr|B4GK65|B4GK65_DROPE GL26016 OS=Drosophila persimilis GN=GL260... 69 1e-10

>tr|A7QML6|A7QML6_VITVI Chromosome chr19 scaffold_126, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002115001
PE=4 SV=1
Length = 1289

Score = 223 bits (568), Expect = 5e-57
Identities = 109/187 (58%), Positives = 142/187 (75%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
DLL+ +AR EGHFD GIVD+KA+ IELQ PKTVH+DPMSGAST + +DRG+TWE+A
Sbjct: 1050 DLLVQNARTEGHFDSGIVDMKANVIELQGTPKTVHIDPMSGASTVMFTFTMDRGITWESA 1109

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+L+ Q D ++GFYESKREWLGR H+LL + S S ++++ RPA GEALREM
Sbjct: 1110 TTLLDEKQKDGLGSASDGFYESKREWLGRRHFLLA--FEGSASGMFKMVRPAVGEALREM 1167

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY +++SLE A ++EY ++ +QCMHGP CK+G+ CTVGRR+QE+ +LGGL
Sbjct: 1168 PLAELKSKYRRVSSLEKARSGWENEYEVSSKQCMHGPNCKLGNFCTVGRRLQEVNVLGGL 1227

Query: 540 ILPVWGT 560
ILP+WGT
Sbjct: 1228 ILPIWGT 1234


>tr|Q7XPM3|Q7XPM3_ORYSJ OSJNBa0085I10.3 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0085I10.3 PE=4 SV=2
Length = 849

Score = 218 bits (556), Expect = 1e-55
Identities = 109/187 (58%), Positives = 138/187 (73%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D++L +AR EG D GIVDIKA ++E++E PKTVH+D +SGAST L +DRG+TWE A
Sbjct: 610 DVVLHNARIEGQLDSGIVDIKAKNVEMKESPKTVHIDSLSGASTVLFTFTIDRGVTWETA 669

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+L+ Q D N+GFYESKREW+G H++L + S+ +Y+I RPA GEALREM
Sbjct: 670 KSMLDERQKDGAGSSNDGFYESKREWMGGRHFILA--FEGSIEGMYKIIRPAIGEALREM 727

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S+E K QDEY+ + +QCMHG KCKVGS CTVGRR+QE+ ILGGL
Sbjct: 728 PLTELKSKYRKVSSIEKVNKGWQDEYDASSKQCMHGSKCKVGSYCTVGRRLQEVNILGGL 787

Query: 540 ILPVWGT 560
ILPVWGT
Sbjct: 788 ILPVWGT 794


>tr|Q25AI3|Q25AI3_ORYSA H0702G05.10 protein OS=Oryza sativa
GN=H0702G05.10 PE=4 SV=1
Length = 1326

Score = 218 bits (556), Expect = 1e-55
Identities = 109/187 (58%), Positives = 138/187 (73%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D++L +AR EG D GIVDIKA ++E++E PKTVH+D +SGAST L +DRG+TWE A
Sbjct: 1087 DVVLHNARIEGQLDSGIVDIKAKNVEMKESPKTVHIDSLSGASTVLFTFTIDRGVTWETA 1146

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+L+ Q D N+GFYESKREW+G H++L + S+ +Y+I RPA GEALREM
Sbjct: 1147 KSMLDERQKDGAGSSNDGFYESKREWMGGRHFILA--FEGSIEGMYKIIRPAIGEALREM 1204

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S+E K QDEY+ + +QCMHG KCKVGS CTVGRR+QE+ ILGGL
Sbjct: 1205 PLTELKSKYRKVSSIEKVNKGWQDEYDASSKQCMHGSKCKVGSYCTVGRRLQEVNILGGL 1264

Query: 540 ILPVWGT 560
ILPVWGT
Sbjct: 1265 ILPVWGT 1271


>tr|Q0JA99|Q0JA99_ORYSJ Os04g0609700 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0609700 PE=4 SV=1
Length = 822

Score = 218 bits (556), Expect = 1e-55
Identities = 109/187 (58%), Positives = 138/187 (73%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D++L +AR EG D GIVDIKA ++E++E PKTVH+D +SGAST L +DRG+TWE A
Sbjct: 583 DVVLHNARIEGQLDSGIVDIKAKNVEMKESPKTVHIDSLSGASTVLFTFTIDRGVTWETA 642

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+L+ Q D N+GFYESKREW+G H++L + S+ +Y+I RPA GEALREM
Sbjct: 643 KSMLDERQKDGAGSSNDGFYESKREWMGGRHFILA--FEGSIEGMYKIIRPAIGEALREM 700

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S+E K QDEY+ + +QCMHG KCKVGS CTVGRR+QE+ ILGGL
Sbjct: 701 PLTELKSKYRKVSSIEKVNKGWQDEYDASSKQCMHGSKCKVGSYCTVGRRLQEVNILGGL 760

Query: 540 ILPVWGT 560
ILPVWGT
Sbjct: 761 ILPVWGT 767


>tr|B8ATX2|B8ATX2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17336 PE=4 SV=1
Length = 1246

Score = 218 bits (556), Expect = 1e-55
Identities = 109/187 (58%), Positives = 138/187 (73%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D++L +AR EG D GIVDIKA ++E++E PKTVH+D +SGAST L +DRG+TWE A
Sbjct: 1007 DVVLHNARIEGQLDSGIVDIKAKNVEMKESPKTVHIDSLSGASTVLFTFTIDRGVTWETA 1066

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+L+ Q D N+GFYESKREW+G H++L + S+ +Y+I RPA GEALREM
Sbjct: 1067 KSMLDERQKDGAGSSNDGFYESKREWMGGRHFILA--FEGSIEGMYKIIRPAIGEALREM 1124

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S+E K QDEY+ + +QCMHG KCKVGS CTVGRR+QE+ ILGGL
Sbjct: 1125 PLTELKSKYRKVSSIEKVNKGWQDEYDASSKQCMHGSKCKVGSYCTVGRRLQEVNILGGL 1184

Query: 540 ILPVWGT 560
ILPVWGT
Sbjct: 1185 ILPVWGT 1191


>tr|B8BBY7|B8BBY7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_28276 PE=4 SV=1
Length = 1488

Score = 214 bits (545), Expect = 3e-54
Identities = 107/186 (57%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D+++ +AR EG D GIVDIKA S++++E PKTVHVD +SGAST L +DRG TWE+A
Sbjct: 1250 DIVIQNARSEGQLDSGIVDIKAKSVKMKESPKTVHVDSLSGASTVLFTFTIDRGFTWESA 1309

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
ILE Q D + GFYES+REW+GR HY+L + S +YR+ RPA GEALREM
Sbjct: 1310 NAILEERQKDGAGSSDVGFYESRREWMGRRHYMLA--FEGSTEGMYRVIRPAVGEALREM 1367

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S++ Q+EY+ + +QCMHGPKCK+GS CTVGRR+QE+ ILGGL
Sbjct: 1368 PLVELKSKYRKVSSIDKIGNGWQEEYDASSKQCMHGPKCKLGSYCTVGRRLQEINILGGL 1427

Query: 540 ILPVWG 557
ILPVWG
Sbjct: 1428 ILPVWG 1433


>tr|Q7F1V5|Q7F1V5_ORYSJ Putative sno protein OS=Oryza sativa subsp.
japonica GN=OJ1006_H01.104 PE=4 SV=1
Length = 1398

Score = 214 bits (544), Expect = 3e-54
Identities = 107/186 (57%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D+++ +AR EG D GIVDIKA S++++E PKTVHVD +SGAST L +DRG TWE+A
Sbjct: 1160 DIVIQNARSEGQLDSGIVDIKAKSVKMKESPKTVHVDSLSGASTVLFTFTIDRGFTWESA 1219

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
ILE Q D + GFYES+REW+GR HY+L + S +YR+ RPA GEALREM
Sbjct: 1220 NAILEERQKDGAGYSDVGFYESRREWMGRRHYMLA--FEGSTEGMYRVIRPAVGEALREM 1277

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S++ Q+EY+ + +QCMHGPKCK+GS CTVGRR+QE+ ILGGL
Sbjct: 1278 PLVELKSKYRKVSSIDKIGNGWQEEYDASSKQCMHGPKCKLGSYCTVGRRLQEINILGGL 1337

Query: 540 ILPVWG 557
ILPVWG
Sbjct: 1338 ILPVWG 1343


>tr|Q0WQ12|Q0WQ12_ARATH Putative uncharacterized protein At1g79350
OS=Arabidopsis thaliana GN=At1g79350 PE=2 SV=1
Length = 624

Score = 214 bits (544), Expect = 3e-54
Identities = 105/187 (56%), Positives = 139/187 (74%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D+L+ +AR EG FD GIVD+KA+S+EL PKTVHVD MSGAST L +DRG+TWE+A
Sbjct: 385 DVLVHNARIEGSFDSGIVDMKANSVELLSTPKTVHVDQMSGASTMLFTFTLDRGVTWESA 444

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+LE + D N+GF+ESKREWLGR H++L + + S +++I RPA GE++REM
Sbjct: 445 SSMLEGKRRDGLGSANDGFFESKREWLGRRHFILA--FESAASGLFKIVRPAVGESIREM 502

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
EL +KY KL+SLE A +DEY ++ +QCMHGPKCK+G CTVGRR+QE+ ++GGL
Sbjct: 503 SLSELKTKYRKLSSLEKARTGWEDEYEVSSKQCMHGPKCKLGEYCTVGRRIQEVNVVGGL 562

Query: 540 ILPVWGT 560
ILP+WGT
Sbjct: 563 ILPIWGT 569


>tr|Q0J779|Q0J779_ORYSJ Os08g0223700 protein OS=Oryza sativa subsp.
japonica GN=Os08g0223700 PE=4 SV=1
Length = 1424

Score = 214 bits (544), Expect = 3e-54
Identities = 107/186 (57%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D+++ +AR EG D GIVDIKA S++++E PKTVHVD +SGAST L +DRG TWE+A
Sbjct: 1186 DIVIQNARSEGQLDSGIVDIKAKSVKMKESPKTVHVDSLSGASTVLFTFTIDRGFTWESA 1245

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
ILE Q D + GFYES+REW+GR HY+L + S +YR+ RPA GEALREM
Sbjct: 1246 NAILEERQKDGAGYSDVGFYESRREWMGRRHYMLA--FEGSTEGMYRVIRPAVGEALREM 1303

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
P EL SKY K++S++ Q+EY+ + +QCMHGPKCK+GS CTVGRR+QE+ ILGGL
Sbjct: 1304 PLVELKSKYRKVSSIDKIGNGWQEEYDASSKQCMHGPKCKLGSYCTVGRRLQEINILGGL 1363

Query: 540 ILPVWG 557
ILPVWG
Sbjct: 1364 ILPVWG 1369


>tr|O64516|O64516_ARATH YUP8H12R.3 protein OS=Arabidopsis thaliana
GN=YUP8H12R.3 PE=4 SV=1
Length = 1257

Score = 214 bits (544), Expect = 3e-54
Identities = 105/187 (56%), Positives = 139/187 (74%), Gaps = 2/187 (1%)
Frame = +3

Query: 6 DLLLSDARREGHFDCGIVDIKAHSIELQERPKTVHVDPMSGASTTLSILKVDRGLTWEAA 185
D+L+ +AR EG FD GIVD+KA+S+EL PKTVHVD MSGAST L +DRG+TWE+A
Sbjct: 1025 DVLVHNARIEGSFDSGIVDMKANSVELLSTPKTVHVDQMSGASTMLFTFTLDRGVTWESA 1084

Query: 186 IKILE--QNDAEKRPNNGFYESKREWLGRAHYLLTIYWPKSMSEVYRIFRPADGEALREM 359
+LE + D N+GF+ESKREWLGR H++L + + S +++I RPA GE++REM
Sbjct: 1085 SSMLEGKRRDGLGSANDGFFESKREWLGRRHFILA--FESAASGLFKIVRPAVGESIREM 1142

Query: 360 PEDELLSKYSKLTSLEMAEKK*QDEYNITDEQCMHGPKCKVGSACTVGRRVQEMFILGGL 539
EL +KY KL+SLE A +DEY ++ +QCMHGPKCK+G CTVGRR+QE+ ++GGL
Sbjct: 1143 SLSELKTKYRKLSSLEKARTGWEDEYEVSSKQCMHGPKCKLGEYCTVGRRIQEVNVVGGL 1202

Query: 540 ILPVWGT 560
ILP+WGT
Sbjct: 1203 ILPIWGT 1209