BP915790
Clone id YMU001_000076_H01
Library
Length 557
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000076_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAGTACTTTAAGGAAGGGAATGACAAGGAAAAGGATGATGCACAAAGACTGATTGATTT
TCAAAATATCCGAGGTGGACGTGTGAAGCTGCAATCTATTGTGGCTCCGGAAATGGAGTT
TGGTAACTCTGAGAAAGGAGATGCCTTGTATGCTATGGAGCTAGCGCTCTCATTGCAGAA
ACTGGCATATGAGAAACTCCTCTACCTTTCCAAGACAGCCGAGCATGAGAGAGATCCACA
GATGCAGGATTTTGTCGATGGAACATTGCTTCCTGATCAAGTGAACCTCATCAAAAAGGT
TGCAGAGTACGTGTCTCAATTACGACGAGTTGGCAAGGGCCATGGTGTGTACCACTTTGA
TCTAAAGCTCCAAGGTTAACTACTTCACTCAAAGGCCAACGTGTAAAACTTAATGAGAAG
GGAAGGGGGATTGGTTGTAAAGAGGAGGTTGTGTACATTTTTCCTACTTACATGGTGTTG
GCGTGGATTTGTGATCGATGTACGGACCAATTGTACAGTTATTGTTTCATGTAAAAAGTT
TCGGCAAAGTGTGCTTT
■■Homology search results ■■ -
sp_hit_id Q94IC4
Definition sp|Q94IC4|FRI2_SOYBN Ferritin-2, chloroplastic OS=Glycine max
Align length 134
Score (bit) 154.0
E-value 3.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915790|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_H01.
(557 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94IC4|FRI2_SOYBN Ferritin-2, chloroplastic OS=Glycine max PE... 154 3e-37
sp|Q948P6|FRI3_SOYBN Ferritin-3, chloroplastic OS=Glycine max PE... 150 3e-36
sp|O65100|FRI3_VIGUN Ferritin-3, chloroplastic OS=Vigna unguicul... 150 4e-36
sp|Q9LYN2|FRI3_ARATH Ferritin-3, chloroplastic OS=Arabidopsis th... 147 3e-35
sp|Q41709|FRI2_VIGUN Ferritin-2, chloroplastic OS=Vigna unguicul... 147 3e-35
sp|Q39101|FRI1_ARATH Ferritin-1, chloroplastic OS=Arabidopsis th... 146 6e-35
sp|Q94FY2|FRI_MALXI Ferritin, chloroplastic OS=Malus xiaojinensi... 145 2e-34
sp|P19976|FRI1_SOYBN Ferritin-1, chloroplastic OS=Glycine max PE... 144 2e-34
sp|Q96540|FRI1_BRANA Ferritin-1, chloroplastic OS=Brassica napus... 144 2e-34
sp|P29036|FRI1_MAIZE Ferritin-1, chloroplastic OS=Zea mays GN=FE... 144 4e-34
sp|Q8H1T3|FRI2_TOBAC Ferritin-2, chloroplastic OS=Nicotiana taba... 141 2e-33
sp|P29390|FRI2_MAIZE Ferritin-2, chloroplastic OS=Zea mays GN=FE... 139 1e-32
sp|Q9S756|FRI4_ARATH Ferritin-4, chloroplastic OS=Arabidopsis th... 138 2e-32
sp|P19975|FRI1_PEA Ferritin-1, chloroplastic OS=Pisum sativum PE... 138 2e-32
sp|P25699|FRI_PHAVU Ferritin, chloroplastic OS=Phaseolus vulgari... 137 3e-32
sp|Q9SRL5|FRI2_ARATH Ferritin-2, chloroplastic OS=Arabidopsis th... 137 3e-32
sp|Q8RX97|FRI1_TOBAC Ferritin-1, chloroplastic OS=Nicotiana taba... 137 4e-32
sp|Q948P5|FRI4_SOYBN Ferritin-4, chloroplastic OS=Glycine max PE... 135 1e-31
sp|P42577|FRIS_LYMST Soma ferritin OS=Lymnaea stagnalis PE=2 SV=2 95 3e-19
sp|Q7SXA5|FRIL_XENLA Ferritin light chain, oocyte isoform OS=Xen... 90 7e-18
sp|P17663|FRIH1_XENLA Ferritin heavy chain 1 OS=Xenopus laevis P... 89 1e-17
sp|P07229|FRI1_RANCA Ferritin, higher subunit OS=Rana catesbeian... 87 4e-17
sp|P07798|FRI2_RANCA Ferritin, middle subunit OS=Rana catesbeian... 87 6e-17
sp|P07797|FRI3_RANCA Ferritin, lower subunit OS=Rana catesbeiana... 86 2e-16
sp|P85838|FRIH_PAGBE Ferritin, heavy subunit OS=Pagothenia berna... 85 2e-16
sp|P25319|FRIH1_SCHMA Ferritin-1 heavy chain OS=Schistosoma mans... 85 3e-16
sp|P49948|FRIH2_XENLA Ferritin heavy chain 2 OS=Xenopus laevis P... 84 4e-16
sp|Q26061|FRI_PACLE Ferritin OS=Pacifastacus leniusculus PE=1 SV=1 83 1e-15
sp|P85836|FRIML_PAGBE Ferritin, liver middle subunit OS=Pagothen... 82 2e-15
sp|P49946|FRIH_SALSA Ferritin, heavy subunit OS=Salmo salar PE=2... 82 2e-15

>sp|Q94IC4|FRI2_SOYBN Ferritin-2, chloroplastic OS=Glycine max PE=2
SV=1
Length = 257

Score = 154 bits (389), Expect = 3e-37
Identities = 78/134 (58%), Positives = 100/134 (74%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++LI +QNIRGGRV L I +P EF +SEKGDALYAMELALSL+K
Sbjct: 128 KFFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEK 187

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL++ AE DPQ DF++ L +QV IKK+AEYV+QLR VGKGHGV+HFD
Sbjct: 188 LTNEKLLHVHSVAERNNDPQXADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFD 247

Query: 362 LKLQG*LLHSKANV 403
K LLH + +V
Sbjct: 248 QK----LLHDEDHV 257


>sp|Q948P6|FRI3_SOYBN Ferritin-3, chloroplastic OS=Glycine max PE=2
SV=1
Length = 256

Score = 150 bits (380), Expect = 3e-36
Identities = 73/123 (59%), Positives = 95/123 (77%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+++QN RGG+VKLQSIV P EF + EKGDALYAMELALSL+K
Sbjct: 126 KFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSEFDHEEKGDALYAMELALSLEK 185

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L A D Q+ DF++ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 186 LTNEKLLNLHSVASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFD 245

Query: 362 LKL 370
L
Sbjct: 246 QML 248


>sp|O65100|FRI3_VIGUN Ferritin-3, chloroplastic OS=Vigna unguiculata
PE=2 SV=1
Length = 256

Score = 150 bits (379), Expect = 4e-36
Identities = 72/123 (58%), Positives = 94/123 (76%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++LI +QNIRGGRV L I +P EF + EKGDALYAMELALSL+K
Sbjct: 131 KFFKESSEEEREHAEKLIKYQNIRGGRVVLHPITSPPSEFEHPEKGDALYAMELALSLEK 190

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLLY+ A+ D Q+ DF++ L +QV IKK+AEYV+QLR VGKGHGV+HFD
Sbjct: 191 LTNEKLLYVHSVADRNNDAQLADFIESEFLNEQVESIKKIAEYVTQLRLVGKGHGVWHFD 250

Query: 362 LKL 370
+L
Sbjct: 251 QRL 253


>sp|Q9LYN2|FRI3_ARATH Ferritin-3, chloroplastic OS=Arabidopsis
thaliana GN=FER3 PE=2 SV=1
Length = 259

Score = 147 bits (371), Expect = 3e-35
Identities = 72/125 (57%), Positives = 94/125 (75%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE + +E++ A+ L+++QN RGGRVKLQ +V P+ EF + EKGDALYAMELALSL+K
Sbjct: 132 KFFKESSVEEREHAELLMEYQNKRGGRVKLQPMVLPQSEFDHPEKGDALYAMELALSLEK 191

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L A D Q+ DF++ L +QV IKK++EYVSQLRR+GKGHG +HFD
Sbjct: 192 LVNEKLLNLHSVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRRLGKGHGTWHFD 251

Query: 362 LKLQG 376
+L G
Sbjct: 252 QELLG 256


>sp|Q41709|FRI2_VIGUN Ferritin-2, chloroplastic OS=Vigna unguiculata
GN=PFE2 PE=2 SV=2
Length = 250

Score = 147 bits (371), Expect = 3e-35
Identities = 71/123 (57%), Positives = 97/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+++QN RGG+VKLQSIV P EF +++KGDAL+AMELALSL+K
Sbjct: 120 KFFKESSEEEREHAEKLMEYQNRRGGKVKLQSIVMPLSEFDHADKGDALHAMELALSLEK 179

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL+L A D Q+ DFV+ L +QV IK+++EYV+QLRRVGKGHGV+HFD
Sbjct: 180 LTNEKLLHLHSVATKNGDVQLADFVESEFLGEQVESIKRISEYVAQLRRVGKGHGVWHFD 239

Query: 362 LKL 370
L
Sbjct: 240 QML 242


>sp|Q39101|FRI1_ARATH Ferritin-1, chloroplastic OS=Arabidopsis
thaliana GN=FER1 PE=1 SV=1
Length = 255

Score = 146 bits (369), Expect = 6e-35
Identities = 68/123 (55%), Positives = 94/123 (76%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E+ A++ +++QN RGGRVKL IV+P EF ++EKGDALYAMELALSL+K
Sbjct: 131 KFFKESSEEERGHAEKFMEYQNQRGGRVKLHPIVSPISEFEHAEKGDALYAMELALSLEK 190

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL + K A DPQ+ DFV+ L +Q+ IKK+++Y++QLR +GKGHGV+HFD
Sbjct: 191 LTNEKLLNVHKVASENNDPQLADFVESEFLGEQIEAIKKISDYITQLRMIGKGHGVWHFD 250

Query: 362 LKL 370
L
Sbjct: 251 QML 253


>sp|Q94FY2|FRI_MALXI Ferritin, chloroplastic OS=Malus xiaojinensis
PE=3 SV=1
Length = 250

Score = 145 bits (365), Expect = 2e-34
Identities = 70/123 (56%), Positives = 93/123 (75%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+ +QN RGGRV L +I EF + EKGDALYAMELALSL+K
Sbjct: 126 KFFKESSEEEREHAEKLMKYQNTRGGRVVLHAIKNVPSEFEHVEKGDALYAMELALSLEK 185

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL + A+ DPQM DF++ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 186 LVNEKLLNVHSVADRNNDPQMADFIESEFLSEQVESIKKISEYVAQLRRVGKGHGVWHFD 245

Query: 362 LKL 370
+L
Sbjct: 246 QRL 248


>sp|P19976|FRI1_SOYBN Ferritin-1, chloroplastic OS=Glycine max PE=1
SV=4
Length = 250

Score = 144 bits (364), Expect = 2e-34
Identities = 70/123 (56%), Positives = 92/123 (74%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+ +QN RGGRV L I EF + EKGDALYAMELALSL+K
Sbjct: 126 KFFKESSEEEREHAEKLMKYQNTRGGRVVLHPIKNAPSEFEHVEKGDALYAMELALSLEK 185

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL + A+ DPQM DF++ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 186 LVNEKLLNVHSVADRNNDPQMADFIESEFLSEQVESIKKISEYVAQLRRVGKGHGVWHFD 245

Query: 362 LKL 370
+L
Sbjct: 246 QRL 248


>sp|Q96540|FRI1_BRANA Ferritin-1, chloroplastic OS=Brassica napus
GN=LSC30 PE=2 SV=1
Length = 254

Score = 144 bits (364), Expect = 2e-34
Identities = 67/123 (54%), Positives = 94/123 (76%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E++ A++ +++QN RGGRV L IV+P +F ++EKGDALYAMELALSL+K
Sbjct: 130 KFFKESSDEEREHAEKFMEYQNQRGGRVTLHPIVSPISDFEHAEKGDALYAMELALSLEK 189

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L + A DPQ+ DFV+ L +Q+ IKK++++++QLR VGKGHGV+HFD
Sbjct: 190 LTNEKLLNLHRVASENNDPQLADFVESEFLGEQIEAIKKISDFITQLRMVGKGHGVWHFD 249

Query: 362 LKL 370
L
Sbjct: 250 QML 252


>sp|P29036|FRI1_MAIZE Ferritin-1, chloroplastic OS=Zea mays GN=FER1
PE=1 SV=2
Length = 254

Score = 144 bits (362), Expect = 4e-34
Identities = 70/123 (56%), Positives = 93/123 (75%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E++ A++L+++QN RGGRV+LQSIV P EF + EKGDALYAMELAL+L+K
Sbjct: 127 KFFKESSDEEREHAEKLMEYQNKRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEK 186

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L A DPQ+ DF++ L +Q I K+++YV+QLRRVGKGHGV+HFD
Sbjct: 187 LVNEKLHNLHGVATRCNDPQLTDFIESEFLEEQGEAINKISKYVAQLRRVGKGHGVWHFD 246

Query: 362 LKL 370
L
Sbjct: 247 QML 249


tr_hit_id A9S9S4
Definition tr|A9S9S4|A9S9S4_PHYPA Ferritin OS=Physcomitrella patens subsp. patens
Align length 124
Score (bit) 164.0
E-value 3.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915790|Adiantum capillus-veneris mRNA, clone:
YMU001_000076_H01.
(557 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S9S4|A9S9S4_PHYPA Ferritin OS=Physcomitrella patens subsp. ... 164 3e-39
tr|Q8LK80|Q8LK80_ORYSJ Ferritin OS=Oryza sativa subsp. japonica ... 157 5e-37
tr|B8BIN0|B8BIN0_ORYSI Putative uncharacterized protein OS=Oryza... 157 5e-37
tr|Q9SWS0|Q9SWS0_SOLTU Ferritin (Fragment) OS=Solanum tuberosum ... 156 6e-37
tr|A8D002|A8D002_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer2 PE=2 ... 156 6e-37
tr|A8CZZ4|A8CZZ4_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer1 PE=2 ... 156 8e-37
tr|Q8L5K0|Q8L5K0_ORYSJ Ferritin OS=Oryza sativa subsp. japonica ... 155 1e-36
tr|A2ZHA2|A2ZHA2_ORYSI Ferritin OS=Oryza sativa subsp. indica GN... 155 1e-36
tr|A9PCK8|A9PCK8_POPTR Ferritin OS=Populus trichocarpa PE=2 SV=1 155 2e-36
tr|A9S6B6|A9S6B6_PHYPA Ferritin, chloroplast OS=Physcomitrella p... 154 3e-36
tr|A9PI96|A9PI96_POPTR Ferritin OS=Populus trichocarpa PE=2 SV=1 154 4e-36
tr|A8D015|A8D015_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer4 PE=2 ... 153 5e-36
tr|B8LPN3|B8LPN3_PICSI Putative uncharacterized protein OS=Picea... 152 9e-36
tr|Q6DQK1|Q6DQK1_TRIMO Ferritin OS=Triticum monococcum GN=Fer1 P... 152 1e-35
tr|B6UZ85|B6UZ85_WHEAT Ferritin 1B (Fragment) OS=Triticum aestiv... 152 1e-35
tr|B6UZ83|B6UZ83_WHEAT Ferritin 1B (Fragment) OS=Triticum aestiv... 152 1e-35
tr|A8D009|A8D009_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer3 PE=2 ... 152 1e-35
tr|Q1L4E2|Q1L4E2_MALDO Ferritin OS=Malus domestica PE=2 SV=1 152 2e-35
tr|B6UZ90|B6UZ90_WHEAT Ferritin 2A OS=Triticum aestivum PE=4 SV=1 152 2e-35
tr|A9PK81|A9PK81_POPJC Ferritin OS=Populus jackii PE=2 SV=1 152 2e-35
tr|Q5G1L6|Q5G1L6_WHEAT Ferritin OS=Triticum aestivum PE=3 SV=1 151 2e-35
tr|B6UZ81|B6UZ81_WHEAT Ferritin 1A (Fragment) OS=Triticum aestiv... 151 2e-35
tr|B6UZ79|B6UZ79_WHEAT Ferritin 1A OS=Triticum aestivum PE=2 SV=1 151 2e-35
tr|B1NC18|B1NC18_HORVU Ferritin OS=Hordeum vulgare GN=Fer1 PE=2 ... 151 2e-35
tr|B6UZ88|B6UZ88_WHEAT Ferritin 2A OS=Triticum aestivum PE=2 SV=1 151 3e-35
tr|A4GSN5|A4GSN5_9POAL Ferritin OS=Triticum urartu PE=3 SV=1 151 3e-35
tr|A3CE65|A3CE65_ORYSJ Ferritin OS=Oryza sativa subsp. japonica ... 151 3e-35
tr|Q94KA2|Q94KA2_ORYSA Ferritin OS=Oryza sativa PE=2 SV=1 150 4e-35
tr|Q4EWB8|Q4EWB8_AVIMR Ferritin OS=Avicennia marina PE=2 SV=1 150 6e-35
tr|A7Q3N8|A7Q3N8_VITVI Ferritin OS=Vitis vinifera GN=GSVIVT00029... 149 8e-35

>tr|A9S9S4|A9S9S4_PHYPA Ferritin OS=Physcomitrella patens subsp.
patens GN=PHYPADRAFT_210187 PE=3 SV=1
Length = 268

Score = 164 bits (415), Expect = 3e-39
Identities = 82/124 (66%), Positives = 99/124 (79%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
+YFK +D+E++ A++L+ +QN RGGRVKLQSIV PEMEF + EKGDALYAMELAL+L+K
Sbjct: 136 QYFKAASDEEREHAEKLMRYQNQRGGRVKLQSIVLPEMEFDHPEKGDALYAMELALALEK 195

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L + A DPQM DFV+G L DQV IK V+EYV+QLRRVGKG GVYHFD
Sbjct: 196 LTNEKLLQLHQAASDANDPQMTDFVEGEFLTDQVEAIKNVSEYVAQLRRVGKGLGVYHFD 255

Query: 362 LKLQ 373
L+LQ
Sbjct: 256 LQLQ 259


>tr|Q8LK80|Q8LK80_ORYSJ Ferritin OS=Oryza sativa subsp. japonica
GN=Fer1 PE=2 SV=1
Length = 251

Score = 157 bits (396), Expect = 5e-37
Identities = 77/123 (62%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E+D A++LI +QN+RGGRV+LQSIV P EF + EKGDALYAMELAL+L+K
Sbjct: 124 KFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEK 183

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L A DPQ+ DFV+ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 184 LVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFD 243

Query: 362 LKL 370
KL
Sbjct: 244 QKL 246


>tr|B8BIN0|B8BIN0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34807 PE=4 SV=1
Length = 251

Score = 157 bits (396), Expect = 5e-37
Identities = 77/123 (62%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E+D A++LI +QN+RGGRV+LQSIV P EF + EKGDALYAMELAL+L+K
Sbjct: 124 KFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEK 183

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L A DPQ+ DFV+ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 184 LVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFD 243

Query: 362 LKL 370
KL
Sbjct: 244 QKL 246


>tr|Q9SWS0|Q9SWS0_SOLTU Ferritin (Fragment) OS=Solanum tuberosum
PE=2 SV=1
Length = 205

Score = 156 bits (395), Expect = 6e-37
Identities = 77/123 (62%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++EK+ A++L+ +QNIRGGRVKL SI+ P EF + +KGDALYAMELALSL+K
Sbjct: 81 KFFKESSEEEKEHAEKLMHYQNIRGGRVKLHSIMMPPSEFDHVDKGDALYAMELALSLEK 140

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L A+ D +MQDFV+ L +QV IKK+AEYVSQLRRVGKGHGV+HFD
Sbjct: 141 LTKEKLLTLHSVADRNNDSEMQDFVEREFLAEQVEAIKKIAEYVSQLRRVGKGHGVWHFD 200

Query: 362 LKL 370
L
Sbjct: 201 QML 203


>tr|A8D002|A8D002_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer2 PE=2
SV=1
Length = 305

Score = 156 bits (395), Expect = 6e-37
Identities = 82/150 (54%), Positives = 109/150 (72%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E+D A++L+++QN RGGRVKLQ+I+ P EF + EKGDALYAMELALSL+K
Sbjct: 147 KFFKESSEEERDHAEKLMEYQNKRGGRVKLQTILMPVSEFDHPEKGDALYAMELALSLEK 206

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL+L A +DPQ+ DFV+ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 207 LTNEKLLHLHSVAVKSKDPQLTDFVETEFLAEQVEAIKKISEYVAQLRRVGKGHGVWHFD 266

Query: 362 LKLQG*LLHSKANV*NLMRREGGLVVKRRL 451
LLH L+R + + VK R+
Sbjct: 267 QA----LLHGML----LLRDDEFVTVKSRV 288


>tr|A8CZZ4|A8CZZ4_PYRPY Ferritin OS=Pyrus pyrifolia GN=Fer1 PE=2
SV=1
Length = 265

Score = 156 bits (394), Expect = 8e-37
Identities = 72/120 (60%), Positives = 97/120 (80%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+++QN RGGRVKL S++A EF ++EKGDALYAMELALSL+K
Sbjct: 135 KFFKESSEEEREHAEKLMEYQNKRGGRVKLHSVIAAPTEFDHAEKGDALYAMELALSLEK 194

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L K A+ DPQ+ DF++ L +QV IKK+A+YV+QLRRVGKGHGV+HFD
Sbjct: 195 LTNEKLLNLHKVADQNNDPQLMDFIESEFLAEQVEAIKKIADYVTQLRRVGKGHGVWHFD 254


>tr|Q8L5K0|Q8L5K0_ORYSJ Ferritin OS=Oryza sativa subsp. japonica
GN=Fer2 PE=2 SV=1
Length = 255

Score = 155 bits (393), Expect = 1e-36
Identities = 76/123 (61%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E+D A++L+ +QN+RGGRV+LQSIV P EF + EKGDALYAMELAL+L+K
Sbjct: 128 KFFKESSDEERDHAEKLMKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEK 187

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L A DPQ+ DFV+ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 188 LVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFD 247

Query: 362 LKL 370
KL
Sbjct: 248 QKL 250


>tr|A2ZHA2|A2ZHA2_ORYSI Ferritin OS=Oryza sativa subsp. indica
GN=OsI_37168 PE=3 SV=1
Length = 255

Score = 155 bits (393), Expect = 1e-36
Identities = 76/123 (61%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +D+E+D A++L+ +QN+RGGRV+LQSIV P EF + EKGDALYAMELAL+L+K
Sbjct: 128 KFFKESSDEERDHAEKLMKYQNMRGGRVRLQSIVTPLTEFDHPEKGDALYAMELALALEK 187

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L A DPQ+ DFV+ L +QV IKK++EYV+QLRRVGKGHGV+HFD
Sbjct: 188 LVNEKLHNLHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGHGVWHFD 247

Query: 362 LKL 370
KL
Sbjct: 248 QKL 250


>tr|A9PCK8|A9PCK8_POPTR Ferritin OS=Populus trichocarpa PE=2 SV=1
Length = 143

Score = 155 bits (391), Expect = 2e-36
Identities = 75/123 (60%), Positives = 96/123 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
K+FKE +++E++ A++L+ +QNIRGG+V L SI+ P EF + EKGDALYAMELALSL+K
Sbjct: 17 KFFKESSEEEREHAEKLMKYQNIRGGKVVLHSILTPVSEFEHVEKGDALYAMELALSLEK 76

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKLL L K A+ DPQMQDF++ L +QV IKK+AEYV+QLR VGKGHGV+HFD
Sbjct: 77 LTNEKLLSLHKVADENNDPQMQDFIESEFLEEQVESIKKIAEYVTQLRMVGKGHGVWHFD 136

Query: 362 LKL 370
L
Sbjct: 137 QTL 139


>tr|A9S6B6|A9S6B6_PHYPA Ferritin, chloroplast OS=Physcomitrella
patens subsp. patens GN=PHYPADRAFT_181672 PE=4 SV=1
Length = 263

Score = 154 bits (389), Expect = 3e-36
Identities = 76/124 (61%), Positives = 97/124 (78%)
Frame = +2

Query: 2 KYFKEGNDKEKDDAQRLIDFQNIRGGRVKLQSIVAPEMEFGNSEKGDALYAMELALSLQK 181
+YFK +D+E++ A++L+ +QN RGG+VKLQSIV P MEF + EKGDALYAMELAL+L+K
Sbjct: 138 QYFKHASDEEREHAEKLMRYQNQRGGKVKLQSIVMPLMEFDHHEKGDALYAMELALALEK 197

Query: 182 LAYEKLLYLSKTAEHERDPQMQDFVDGTLLPDQVNLIKKVAEYVSQLRRVGKGHGVYHFD 361
L EKL L + A D QM +F++ L +QV IKKV+EYVSQLRRVG+GHGVYHFD
Sbjct: 198 LTNEKLFQLHQAAADANDHQMTEFIEREFLTEQVEAIKKVSEYVSQLRRVGQGHGVYHFD 257

Query: 362 LKLQ 373
L+LQ
Sbjct: 258 LQLQ 261