BP915807
Clone id YMU001_000077_B11
Library
Length 618
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000077_B11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGGAAGAATTCGCGGCCGCAGGAATGTGAGTGACACACCATTCTCCCTTGTGAGCTTGTC
TGTTGTATGACTGTGTGCTAGGAGCCTTTGTGGCTCGCACATGGCGCGTAGCAAGTCCCT
AGCCTTGACAAATCATAAACTACAAATTCGGCTAGATATTGAGTAGTATCTATGGGATTC
TAGAGGTTATAATGCTAAACCCAGGTTTGTCATGTTTGTTGTATTTATCACTTCATCATT
GTCCCCAAGGTTCCACTTAAAGAGATTCATTATTCTTTTGACATGCTCCATGGCTCCTTT
TGGATCCAAACGCCCAAAGGGAACTAAGAAAACATGAATATAGTGTTTTTTTGTATTGAG
CATGACTATAGAAAATTTGATGATAGGTCCACTGAATGGCAAAAACACACTTTTTGGTAC
CTATTTTAGTTGCCCTAAAAAAAAATAGTGAGGCAAAAGTAACCATATTTTTTGATCACC
AACCCATTGAAGTTAACGAAAAACTTTATCTTATGTCCTACAAAAATCTCCACTCTTATT
TATATGCAATCAACCGTACAAAATGACTGTTGTGGGCAAAATGTACTGGTCCATCAACTT
TGGACGGTTGTTGTGACC
■■Homology search results ■■ -
sp_hit_id Q05FH9
Definition sp|Q05FH9|RPOC_CARRP DNA-directed RNA polymerase subunit beta' OS=Carsonella ruddii (strain PV)
Align length 36
Score (bit) 30.8
E-value 5.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915807|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_B11.
(593 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q05FH9|RPOC_CARRP DNA-directed RNA polymerase subunit beta' O... 31 5.3
sp|Q49Z00|REX_STAS1 Redox-sensing transcriptional repressor rex ... 30 9.1

>sp|Q05FH9|RPOC_CARRP DNA-directed RNA polymerase subunit beta'
OS=Carsonella ruddii (strain PV) GN=rpoC PE=3 SV=1
Length = 1292

Score = 30.8 bits (68), Expect = 5.3
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = -2

Query: 475 FVNFNGLVIKKYGYFCLTIFF*GN*NRYQKVCFCHS 368
F+NF L + G FCL IF +K CFCH+
Sbjct: 32 FINFKNLKPEPNGLFCLKIFSDFELCCLKKKCFCHN 67


>sp|Q49Z00|REX_STAS1 Redox-sensing transcriptional repressor rex
OS=Staphylococcus saprophyticus subsp. saprophyticus
(strain ATCC 15305 / DSM 20229) GN=rex PE=3 SV=1
Length = 213

Score = 30.0 bits (66), Expect = 9.1
Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Frame = -1

Query: 293 FGRLDPKGAMEHVKRIMNLFKWNLGDNDEV-INTTNMTNLGLAL 165
FG L KG ++ +++ FK + +NDE+ I + NLG AL
Sbjct: 57 FGELGKKGYGYNIDSLLHFFKNEISENDEIKIAIVGVGNLGKAL 100


tr_hit_id Q5CG57
Definition tr|Q5CG57|Q5CG57_CRYHO Putative uncharacterized protein OS=Cryptosporidium hominis
Align length 87
Score (bit) 36.2
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915807|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_B11.
(593 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5CG57|Q5CG57_CRYHO Putative uncharacterized protein OS=Crypt... 36 1.4

>tr|Q5CG57|Q5CG57_CRYHO Putative uncharacterized protein
OS=Cryptosporidium hominis GN=Chro.10243 PE=4 SV=1
Length = 934

Score = 36.2 bits (82), Expect = 1.4
Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 5/87 (5%)
Frame = -1

Query: 368 SGPIIKFSIVMLNTKKHYIHVFLVPFGRLDPKGA-----MEHVKRIMNLFKWNLGDNDEV 204
SG I+ +L+ KH I + L+ LDP EH++ I + N D +E+
Sbjct: 730 SGVCIRSFKELLDVIKHVIQLILIVAPTLDPGNEDYQPYQEHLEVINSQLTTNQSDRNEL 789

Query: 203 INTTNMTNLGLAL*PLESHRYYSISSR 123
I T N GLA + +S+SSR
Sbjct: 790 IKNTEFLNSGLA-----QNNIFSLSSR 811