BP915808
Clone id YMU001_000077_B12
Library
Length 579
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000077_B12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGAAGTCCTGACAGCGAAGGATACAGGGGACGCTCTCACAATGCTGCAATCCTTAGTTA
GTGCAACCTTTGATAGCAGTCTTCGAGCCTCCTGTGTTGCTATTTAATTCATGTTCCATG
CGCACCATCACCTGAATCATAGCTTGATCTTGCTCTGACTTGTCTGCGAGAGCACGTCTC
AAATACGCTGCTTCAGATTCCAAAGTTTCCACCTTTGCAGACAGTAGTCTTCGGTTATCT
TCTTTTACCAACTCCATAAAGGCAGTGTCCAGATCCTCTGCTCTTAAACTTGCAACCCGT
CTATCTTCTAGTGCTCTAGAAAGCTCAAGTTTCATGTAGCTGATCTGGCTTATGAGATTC
GCAAGCATGGTCCTCTTGTCCACAAATCCATCCTGAGCAATGTCAGTTGACCAACAGGCT
CTTTCAATTTCTACACGAGCTGGCATAACTTCCACAATTTTCCAAGAGTGCATCAGCACC
ACCATTAACACCTGCAGCTTGCATGGATAGACTTTGCCCTGAACTTTTCTTCGAAATTGG
CTCAGCATCAGCATCACTTGTCTTGTCACACTCCAGAAA
■■Homology search results ■■ -
sp_hit_id A0Q844
Definition sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisella tularensis subsp. novicida (strain U112)
Align length 116
Score (bit) 36.2
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915808|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_B12.
(579 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisell... 36 0.12
sp|Q8PCZ4|ATPE_XANCP ATP synthase epsilon chain OS=Xanthomonas c... 36 0.12
sp|Q4UQF5|ATPE_XANC8 ATP synthase epsilon chain OS=Xanthomonas c... 36 0.12
sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 OS=Francisell... 36 0.16
sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 OS=Francisell... 36 0.16
sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 OS=Francisell... 36 0.16
sp|A7NE96|RF1_FRATF Peptide chain release factor 1 OS=Francisell... 36 0.16
sp|Q3BP16|ATPE_XANC5 ATP synthase epsilon chain OS=Xanthomonas c... 35 0.27
sp|Q8PGG8|ATPE_XANAC ATP synthase epsilon chain OS=Xanthomonas a... 35 0.27
sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 OS=Francisell... 34 0.46
sp|Q14JR1|RF1_FRAT1 Peptide chain release factor 1 OS=Francisell... 34 0.46
sp|P19474|RO52_HUMAN 52 kDa Ro protein OS=Homo sapiens GN=TRIM21... 33 1.0
sp|Q9XHR2|EIF3A_MAIZE Eukaryotic translation initiation factor 3... 33 1.0
sp|Q99816|TS101_HUMAN Tumor susceptibility gene 101 protein OS=H... 32 1.8
sp|Q62191|RO52_MOUSE 52 kDa Ro protein OS=Mus musculus GN=Trim21... 32 1.8
sp|Q04183|TR120_YEAST Transport protein particle 120 kDa subunit... 32 2.3
sp|Q7YRV4|RO52_BOVIN 52 kDa Ro protein OS=Bos taurus GN=TRIM21 P... 32 2.3
sp|A5ILK0|EX7L_THEP1 Exodeoxyribonuclease 7 large subunit OS=The... 32 2.3
sp|Q5H4Y3|ATPE_XANOR ATP synthase epsilon chain OS=Xanthomonas o... 32 2.3
sp|Q2P7Q3|ATPE_XANOM ATP synthase epsilon chain OS=Xanthomonas o... 32 2.3
sp|A4VTE9|CNPD_STRSY 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 32 3.0
sp|A4VZM7|CNPD_STRS2 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 32 3.0
sp|B0TX37|RF1_FRAP2 Peptide chain release factor 1 OS=Francisell... 31 3.9
sp|A6PWD2|FHAD1_MOUSE Forkhead-associated domain-containing prot... 31 3.9
sp|B1AJZ9|FHAD1_HUMAN Forkhead-associated domain-containing prot... 31 3.9
sp|Q5D7J1|TRIM5_PANTR Tripartite motif-containing protein 5 OS=P... 31 5.1
sp|Q1ACD8|TRIM5_PANPA Tripartite motif-containing protein 5 OS=P... 31 5.1
sp|B0UWK9|SYP_HAES2 Prolyl-tRNA synthetase OS=Haemophilus somnus... 31 5.1
sp|Q2JMR8|KSGA_SYNJB Dimethyladenosine transferase OS=Synechococ... 31 5.1
sp|Q14532|K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapie... 31 5.1

>sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisella
tularensis subsp. novicida (strain U112) GN=prfA PE=3
SV=1
Length = 361

Score = 36.2 bits (82), Expect = 0.12
Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ E ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQILLLPRDPNDDANVFL------EIRAGTGGDEASI 128


>sp|Q8PCZ4|ATPE_XANCP ATP synthase epsilon chain OS=Xanthomonas
campestris pv. campestris GN=atpC PE=3 SV=1
Length = 140

Score = 36.2 bits (82), Expect = 0.12
Identities = 20/60 (33%), Positives = 39/60 (65%)
Frame = -2

Query: 290 SLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEH 111
++RA+D+D A + KE+ RLL+ + +T++ E A +R LA+ + Q QA+ ++ ++H
Sbjct: 83 AIRAQDIDEAAVRKAKEEAERLLANRGDTVDVEQA--QRQLAEATVQLQALERLRRTLKH 140


>sp|Q4UQF5|ATPE_XANC8 ATP synthase epsilon chain OS=Xanthomonas
campestris pv. campestris (strain 8004) GN=atpC PE=3
SV=1
Length = 140

Score = 36.2 bits (82), Expect = 0.12
Identities = 20/60 (33%), Positives = 39/60 (65%)
Frame = -2

Query: 290 SLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEH 111
++RA+D+D A + KE+ RLL+ + +T++ E A +R LA+ + Q QA+ ++ ++H
Sbjct: 83 AIRAQDIDEAAVRKAKEEAERLLANRGDTVDVEQA--QRQLAEATVQLQALERLRRTLKH 140


>sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 OS=Francisella
tularensis subsp. tularensis (strain WY96-3418) GN=prfA
PE=3 SV=1
Length = 361

Score = 35.8 bits (81), Expect = 0.16
Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ E ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQIFLLPRDPNDDANVFL------EIRAGTGGDEASI 128


>sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 OS=Francisella
tularensis subsp. holarctica (strain OSU18) GN=prfA PE=3
SV=1
Length = 361

Score = 35.8 bits (81), Expect = 0.16
Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ E ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQIFLLPRDPNDDANVFL------EIRAGTGGDEASI 128


>sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 OS=Francisella
tularensis subsp. holarctica (strain LVS) GN=prfA PE=3
SV=1
Length = 361

Score = 35.8 bits (81), Expect = 0.16
Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ E ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQIFLLPRDPNDDANVFL------EIRAGTGGDEASI 128


>sp|A7NE96|RF1_FRATF Peptide chain release factor 1 OS=Francisella
tularensis subsp. holarctica (strain FTA) GN=prfA PE=3
SV=1
Length = 361

Score = 35.8 bits (81), Expect = 0.16
Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ E ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQIFLLPRDPNDDANVFL------EIRAGTGGDEASI 128


>sp|Q3BP16|ATPE_XANC5 ATP synthase epsilon chain OS=Xanthomonas
campestris pv. vesicatoria (strain 85-10) GN=atpC PE=3
SV=1
Length = 140

Score = 35.0 bits (79), Expect = 0.27
Identities = 20/60 (33%), Positives = 38/60 (63%)
Frame = -2

Query: 290 SLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEH 111
++RA+D+D A + VKE+ RLL+ + T+ + A +R LA+ + Q QA+ ++ ++H
Sbjct: 83 AVRAQDIDEAAVRKVKEEAERLLANRGNTV--DVAEAQRQLAEATVQLQALERLRRNLKH 140


>sp|Q8PGG8|ATPE_XANAC ATP synthase epsilon chain OS=Xanthomonas
axonopodis pv. citri GN=atpC PE=3 SV=1
Length = 140

Score = 35.0 bits (79), Expect = 0.27
Identities = 20/60 (33%), Positives = 38/60 (63%)
Frame = -2

Query: 290 SLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEH 111
++RA+D+D A + VKE+ RLL+ + T+ + A +R LA+ + Q QA+ ++ ++H
Sbjct: 83 AVRAQDIDEAAVRKVKEEAERLLANRGNTV--DVAEAQRQLAEATVQLQALERLRRNLKH 140


>sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 OS=Francisella
tularensis subsp. tularensis GN=prfA PE=3 SV=1
Length = 361

Score = 34.3 bits (77), Expect = 0.46
Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
Frame = -2

Query: 401 IAQDGFVDKRTMLANLISQISYMK------LELSRALEDRRVASLRAEDLDTAFMELVKE 240
+++ G + + +L + S+++ + ++ALED++ A + D +E+ KE
Sbjct: 23 LSEAGIISDQNKFRDLSKEYSHLEPIVKAFKKYTQALEDKQAAYEMLNEKDAELVEMAKE 82

Query: 239 DNRRLLSAKVETLESEAAYLRRALADKSEQDQAMIQVMVRMEHELNSNTGGSKTAI 72
+ +L + +E LESE L+ L + D A + + E+ + TGG + +I
Sbjct: 83 E-LKLANEAIEKLESE---LQIFLLPRDPNDDANVFL------EIRAGTGGDEASI 128


tr_hit_id Q8H8T8
Definition tr|Q8H8T8|Q8H8T8_ORYSJ Putative lyncein OS=Oryza sativa subsp. japonica
Align length 84
Score (bit) 101.0
E-value 3.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915808|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_B12.
(579 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8H8T8|Q8H8T8_ORYSJ Putative lyncein OS=Oryza sativa subsp. j... 101 3e-20
tr|Q0DSW7|Q0DSW7_ORYSJ Os03g0283800 protein OS=Oryza sativa subs... 101 3e-20
tr|B8ALI8|B8ALI8_ORYSI Putative uncharacterized protein OS=Oryza... 101 3e-20
tr|A7Q405|A7Q405_VITVI Chromosome chr13 scaffold_48, whole genom... 99 1e-19
tr|Q6I5K0|Q6I5K0_ORYSJ Os05g0465100 protein OS=Oryza sativa subs... 98 4e-19
tr|A2Y5J3|A2Y5J3_ORYSI Putative uncharacterized protein OS=Oryza... 98 4e-19
tr|Q5QMF8|Q5QMF8_ORYSJ RabGAP/TBC domain-containing protein-like... 97 8e-19
tr|Q0JHZ0|Q0JHZ0_ORYSJ Os01g0835000 protein OS=Oryza sativa subs... 97 8e-19
tr|A2ZZB6|A2ZZB6_ORYSJ Putative uncharacterized protein OS=Oryza... 97 8e-19
tr|A2WWQ8|A2WWQ8_ORYSI Putative uncharacterized protein OS=Oryza... 97 8e-19
tr|Q56WR2|Q56WR2_ARATH Putative uncharacterized protein OS=Arabi... 95 2e-18
tr|A7PST9|A7PST9_VITVI Chromosome chr8 scaffold_29, whole genome... 94 7e-18
tr|Q9M2W4|Q9M2W4_ARATH Putative uncharacterized protein T15C9_20... 87 9e-16
tr|A9RVM8|A9RVM8_PHYPA Predicted protein (Fragment) OS=Physcomit... 84 4e-15
tr|Q10N37|Q10N37_ORYSJ TBC domain containing protein, expressed ... 61 5e-08
tr|A3AGR1|A3AGR1_ORYSJ Putative uncharacterized protein OS=Oryza... 61 5e-08
tr|A8H435|A8H435_SHEPA GreA/GreB family elongation factor OS=She... 39 0.27
tr|Q9ZUT7|Q9ZUT7_ARATH Putative uncharacterized protein At2g3729... 37 0.79
tr|A7N6C7|A7N6C7_VIBHB Putative uncharacterized protein OS=Vibri... 37 1.0
tr|A6AJN5|A6AJN5_VIBHA Methyl-accepting chemotaxis protein OS=Vi... 37 1.0
tr|Q07IM1|Q07IM1_RHOP5 Putative uncharacterized protein OS=Rhodo... 36 1.3
tr|B0RWC1|B0RWC1_XANCB ATP synthase epsilon chain OS=Xanthomonas... 36 1.3
tr|B4APW1|B4APW1_FRANO Peptide chain release factor 1 OS=Francis... 36 1.3
tr|Q69LU7|Q69LU7_ORYSJ Cell wall protein-like OS=Oryza sativa su... 36 1.3
tr|O80953|O80953_ARATH Putative uncharacterized protein At2g3928... 36 1.3
tr|B2SFF6|B2SFF6_FRATM Peptide chain release factor 1 OS=Francis... 36 1.8
tr|A7YUT2|A7YUT2_FRATU Peptide chain release factor 1 OS=Francis... 36 1.8
tr|A7JNK7|A7JNK7_FRANO Peptide chain release factor 1 OS=Francis... 36 1.8
tr|A4KT06|A4KT06_FRATU Peptide chain release factor 1 OS=Francis... 36 1.8
tr|Q1VXM7|Q1VXM7_9FLAO Putative uncharacterized protein OS=Psych... 35 2.3

>tr|Q8H8T8|Q8H8T8_ORYSJ Putative lyncein OS=Oryza sativa subsp.
japonica PE=4 SV=1
Length = 892

Score = 101 bits (252), Expect = 3e-20
Identities = 47/84 (55%), Positives = 70/84 (83%)
Frame = -2

Query: 359 NLISQISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYL 180
+L Q++++K+EL + LE++R A LR+E+L+TA ME+VK+DNR +LSAKVE LE+E + L
Sbjct: 690 DLQDQVTWLKVELCKLLEEKRSAELRSEELETALMEMVKQDNRHMLSAKVEKLEAEVSEL 749

Query: 179 RRALADKSEQDQAMIQVMVRMEHE 108
R++ ADK EQ+QAM+QV++RME E
Sbjct: 750 RKSFADKQEQEQAMLQVLIRMEQE 773



Score = 37.7 bits (86), Expect = 0.46
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 558 LVTTKDAGDAITLLQSLAGSTFDSS 582


>tr|Q0DSW7|Q0DSW7_ORYSJ Os03g0283800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0283800 PE=4 SV=1
Length = 883

Score = 101 bits (252), Expect = 3e-20
Identities = 47/84 (55%), Positives = 70/84 (83%)
Frame = -2

Query: 359 NLISQISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYL 180
+L Q++++K+EL + LE++R A LR+E+L+TA ME+VK+DNR +LSAKVE LE+E + L
Sbjct: 681 DLQDQVTWLKVELCKLLEEKRSAELRSEELETALMEMVKQDNRHMLSAKVEKLEAEVSEL 740

Query: 179 RRALADKSEQDQAMIQVMVRMEHE 108
R++ ADK EQ+QAM+QV++RME E
Sbjct: 741 RKSFADKQEQEQAMLQVLIRMEQE 764



Score = 37.7 bits (86), Expect = 0.46
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 549 LVTTKDAGDAITLLQSLAGSTFDSS 573


>tr|B8ALI8|B8ALI8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11058 PE=4 SV=1
Length = 830

Score = 101 bits (252), Expect = 3e-20
Identities = 47/84 (55%), Positives = 70/84 (83%)
Frame = -2

Query: 359 NLISQISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYL 180
+L Q++++K+EL + LE++R A LR+E+L+TA ME+VK+DNR +LSAKVE LE+E + L
Sbjct: 628 DLQDQVTWLKVELCKLLEEKRSAELRSEELETALMEMVKQDNRHMLSAKVEKLEAEVSEL 687

Query: 179 RRALADKSEQDQAMIQVMVRMEHE 108
R++ ADK EQ+QAM+QV++RME E
Sbjct: 688 RKSFADKQEQEQAMLQVLIRMEQE 711



Score = 37.7 bits (86), Expect = 0.46
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 496 LVTTKDAGDAITLLQSLAGSTFDSS 520


>tr|A7Q405|A7Q405_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029489001
PE=4 SV=1
Length = 722

Score = 99.4 bits (246), Expect = 1e-19
Identities = 49/84 (58%), Positives = 68/84 (80%)
Frame = -2

Query: 359 NLISQISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYL 180
+L Q+ ++K+EL + LE++R A LRAE+L+TA ME+VK+DNRR LSA+VE LE E + L
Sbjct: 509 DLQEQVRWLKVELCKLLEEKRSALLRAEELETALMEMVKQDNRRQLSARVEQLEQEVSEL 568

Query: 179 RRALADKSEQDQAMIQVMVRMEHE 108
R+ALADK EQ+ AM+QV+VR+E E
Sbjct: 569 RQALADKQEQEHAMLQVLVRVEQE 592



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 380 LVTTKDAGDAVTLLQSLAGSTFDSS 404


>tr|Q6I5K0|Q6I5K0_ORYSJ Os05g0465100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0009E21.5 PE=2 SV=1
Length = 830

Score = 97.8 bits (242), Expect = 4e-19
Identities = 50/81 (61%), Positives = 64/81 (79%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
QIS++K EL R LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE E E + LR+ L
Sbjct: 554 QISWLKFELCRLLEERRSAVLRADELETALMEMVKQDNRRQLSAKVEQSEQELSELRQTL 613

Query: 167 ADKSEQDQAMIQVMVRMEHEL 105
DK EQ+QAM QV++R+E EL
Sbjct: 614 LDKQEQEQAMCQVLLRVEQEL 634



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 420 LVTTKDAGDAVTLLQSLAGSTFDSS 444


>tr|A2Y5J3|A2Y5J3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20262 PE=4 SV=1
Length = 830

Score = 97.8 bits (242), Expect = 4e-19
Identities = 50/81 (61%), Positives = 64/81 (79%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
QIS++K EL R LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE E E + LR+ L
Sbjct: 554 QISWLKFELCRLLEERRSAVLRADELETALMEMVKQDNRRQLSAKVEQSEQELSELRQTL 613

Query: 167 ADKSEQDQAMIQVMVRMEHEL 105
DK EQ+QAM QV++R+E EL
Sbjct: 614 LDKQEQEQAMCQVLLRVEQEL 634



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 420 LVTTKDAGDAVTLLQSLAGSTFDSS 444


>tr|Q5QMF8|Q5QMF8_ORYSJ RabGAP/TBC domain-containing protein-like
OS=Oryza sativa subsp. japonica GN=P0506B12.13 PE=4 SV=1
Length = 843

Score = 96.7 bits (239), Expect = 8e-19
Identities = 48/80 (60%), Positives = 66/80 (82%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
Q+ ++K+EL + LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE LE E + LR+AL
Sbjct: 560 QVVWLKVELCQLLEERRSAVLRADELETALMEMVKQDNRRELSAKVEQLEQELSDLRQAL 619

Query: 167 ADKSEQDQAMIQVMVRMEHE 108
DK EQ+QAM+QV++R+E E
Sbjct: 620 LDKQEQEQAMLQVLMRVEQE 639



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 432 LVTTKDAGDAVTLLQSLAGSTFDSS 456


>tr|Q0JHZ0|Q0JHZ0_ORYSJ Os01g0835000 protein OS=Oryza sativa subsp.
japonica GN=Os01g0835000 PE=4 SV=1
Length = 840

Score = 96.7 bits (239), Expect = 8e-19
Identities = 48/80 (60%), Positives = 66/80 (82%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
Q+ ++K+EL + LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE LE E + LR+AL
Sbjct: 576 QVVWLKVELCQLLEERRSAVLRADELETALMEMVKQDNRRELSAKVEQLEQELSDLRQAL 635

Query: 167 ADKSEQDQAMIQVMVRMEHE 108
DK EQ+QAM+QV++R+E E
Sbjct: 636 LDKQEQEQAMLQVLMRVEQE 655



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 448 LVTTKDAGDAVTLLQSLAGSTFDSS 472


>tr|A2ZZB6|A2ZZB6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003888 PE=4 SV=1
Length = 826

Score = 96.7 bits (239), Expect = 8e-19
Identities = 48/80 (60%), Positives = 66/80 (82%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
Q+ ++K+EL + LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE LE E + LR+AL
Sbjct: 562 QVVWLKVELCQLLEERRSAVLRADELETALMEMVKQDNRRELSAKVEQLEQELSDLRQAL 621

Query: 167 ADKSEQDQAMIQVMVRMEHE 108
DK EQ+QAM+QV++R+E E
Sbjct: 622 LDKQEQEQAMLQVLMRVEQE 641



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 434 LVTTKDAGDAVTLLQSLAGSTFDSS 458


>tr|A2WWQ8|A2WWQ8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04332 PE=4 SV=1
Length = 824

Score = 96.7 bits (239), Expect = 8e-19
Identities = 48/80 (60%), Positives = 66/80 (82%)
Frame = -2

Query: 347 QISYMKLELSRALEDRRVASLRAEDLDTAFMELVKEDNRRLLSAKVETLESEAAYLRRAL 168
Q+ ++K+EL + LE+RR A LRA++L+TA ME+VK+DNRR LSAKVE LE E + LR+AL
Sbjct: 560 QVVWLKVELCQLLEERRSAVLRADELETALMEMVKQDNRRELSAKVEQLEQELSDLRQAL 619

Query: 167 ADKSEQDQAMIQVMVRMEHE 108
DK EQ+QAM+QV++R+E E
Sbjct: 620 LDKQEQEQAMLQVLMRVEQE 639



Score = 37.4 bits (85), Expect = 0.60
Identities = 16/25 (64%), Positives = 21/25 (84%)
Frame = +3

Query: 6 VLTAKDTGDALTMLQSLVSATFDSS 80
++T KD GDA+T+LQSL +TFDSS
Sbjct: 432 LVTTKDAGDAVTLLQSLAGSTFDSS 456