BP915812
Clone id YMU001_000077_C06
Library
Length 522
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000077_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCTAGTATTCTCATATTTCTCAGAAAGGCTGCACAAGCGTTTAATGAAGTTGCCGACTA
ACAATGCACGTTGTCCTCCCATCCTCTGATACAACCTCAAACCCAAGTTTCAGCTGCATC
ACAGCATTGTGTACAGCTTGCCTATCTTCATCTGTTAACCATGCAGAGAGCCTAAGGAAA
GCTCTGGAATGCTCCTCCTCAAGTAGAGTACTCGAGCGCTATATCCCCCTTCAAGCCTTC
CAATTCAGTGAAAAATTTTGATCCAACAGCATTCCCGGCATGGACTTGAAAACTCTCCTC
AGCAAAGTTTTGTAAGAGCTCCTCAATAGAAGCTATCCAAATTGGCTCTGCAACACGTAG
GAACTCCCGTATAGCTAGCAATGGAAGAGGAACCTTTCCCAATTTCGTCTCATCAGGATC
TCCTCTCCCATGGAAATCGGAACCTCCAAGTTTCAAGAGTTGAAAGGTATCTGCCAAAGC
CACAAATCCATTAGCTTTGCCGTCACCTCTGTACACTTCCAT
■■Homology search results ■■ -
sp_hit_id Q58FA4
Definition sp|Q58FA4|E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus
Align length 149
Score (bit) 35.8
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915812|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_C06.
(522 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q58FA4|E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus G... 36 0.13
sp|Q8UHI5|LPXK_AGRT5 Tetraacyldisaccharide 4'-kinase OS=Agrobact... 33 1.1
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase ... 32 1.8
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditi... 32 2.4
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccha... 31 3.1
sp|Q6CW35|JJJ2_KLULA J protein JJJ2 OS=Kluyveromyces lactis GN=J... 30 5.3
sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial OS=Neur... 30 5.3
sp|Q2SL23|CAPP_HAHCH Phosphoenolpyruvate carboxylase OS=Hahella ... 30 6.9
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya go... 30 6.9
sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens GN=... 24 7.5
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharo... 30 9.0

>sp|Q58FA4|E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus
GN=E2f8 PE=1 SV=1
Length = 860

Score = 35.8 bits (81), Expect = 0.13
Identities = 36/149 (24%), Positives = 58/149 (38%)
Frame = +2

Query: 74 SSHPLIQPQTQVSAASQHCVQLAYLHLLTMQRA*GKLWNAPPQVEYSSAISPFKPSNSVK 253
S+ P+I PQ + +Q A +LT P S + P +PSN+
Sbjct: 505 SAVPVILPQAPSGPSYAIYLQPAQAQMLT------------PPPGLSPTVCPTQPSNATG 552

Query: 254 NFDPTAFPAWT*KLSSAKFCKSSSIEAIQIGSATRRNSRIASNGRGTFPNFVSSGSPLPW 433
+ DPT PA + ++ + S++ + S+ + RGT +
Sbjct: 553 SKDPTDAPA---EKTATDAATTGSLQPAPERHGAKHRSKETTGDRGTKRMITAE------ 603

Query: 434 KSEPPSFKS*KVSAKATNPLALPSPLYTS 520
S P S K K KA + P+PL+ S
Sbjct: 604 DSGPSSVKKPKEDLKALENVPTPTPLFPS 632


>sp|Q8UHI5|LPXK_AGRT5 Tetraacyldisaccharide 4'-kinase
OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970)
GN=lpxK PE=3 SV=1
Length = 348

Score = 32.7 bits (73), Expect = 1.1
Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
Frame = -1

Query: 405 KLGKVPLPLLAIREFLRVAEPIWIASI-EELLQNFAEESFQVHAGNAVGSKFFTELEGLK 229
K+GK +R+ + A+P+++A+I + ++F + AG A +KF+ +E L
Sbjct: 192 KVGKGHAADPLVRQAAKAAKPVFVAAIMPQEPEDFRGKRVLAFAGIADPAKFYRTVEALG 251

Query: 228 GDIALEYS 205
GDI L S
Sbjct: 252 GDIVLSRS 259


>sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1
OS=Schizosaccharomyces pombe GN=syj1 PE=1 SV=1
Length = 1076

Score = 32.0 bits (71), Expect = 1.8
Identities = 32/104 (30%), Positives = 43/104 (41%)
Frame = +2

Query: 191 APPQVEYSSAISPFKPSNSVKNFDPTAFPAWT*KLSSAKFCKSSSIEAIQIGSATRRNSR 370
APP EY PS + F+PTA P W + KSS I++I S
Sbjct: 931 APPGPEYR-----LNPSRPINPFEPTAEPDWISNTKQSFDKKSSLIDSIPALSPAP---- 981

Query: 371 IASNGRGTFPNFVSSGSPLPWKSEPPSFKS*KVSAKATNPLALP 502
+S R + + SS S +P K P+ K + A PL P
Sbjct: 982 -SSLARSSVSSQRSSTSIIPIKPNKPT-KPDHLVAPRVKPLLPP 1023


>sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis
elegans GN=elt-2 PE=2 SV=1
Length = 433

Score = 31.6 bits (70), Expect = 2.4
Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 3/110 (2%)
Frame = +2

Query: 74 SSHPLIQPQTQVSAASQHC---VQLAYLHLLTMQRA*GKLWNAPPQVEYSSAISPFKPSN 244
S++P + P + SQ C ++ ++ + + K +PP V YS+++ P
Sbjct: 142 STYPTVAPTYECVKCSQSCGAGMKAVNGGMMCVNCSTPKTTYSPP-VAYSTSLGQ-PPIL 199

Query: 245 SVKNFDPTAFPAWT*KLSSAKFCKSSSIEAIQIGSATRRNSRIASNGRGT 394
+ + PTA K++ KSSS GSA+RR + SN GT
Sbjct: 200 EIPSEQPTA------KIAKQSSKKSSSSNRGSNGSASRRQGLVCSNCNGT 243


>sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6
OS=Saccharomyces cerevisiae GN=AVT6 PE=1 SV=1
Length = 448

Score = 31.2 bits (69), Expect = 3.1
Identities = 21/64 (32%), Positives = 34/64 (53%)
Frame = -1

Query: 402 LGKVPLPLLAIREFLRVAEPIWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKGD 223
+G++ + LL + F P ASI ++LQ+FAEE+ + A +A TE L D
Sbjct: 273 IGRIAIVLLVMLAFPLQCHPAR-ASIHQILQHFAEENVSISATSADEPTVATESSPLIRD 331

Query: 222 IALE 211
+L+
Sbjct: 332 SSLD 335


>sp|Q6CW35|JJJ2_KLULA J protein JJJ2 OS=Kluyveromyces lactis GN=JJJ2
PE=3 SV=1
Length = 653

Score = 30.4 bits (67), Expect = 5.3
Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
Frame = +2

Query: 179 KLWNAPPQVEYSSAISPFKPSN-SVKNFDPTAFPAWT*KLSSAKFCKSSSIEAIQIGSAT 355
K +NA +++P +P S KN T+F SS K+ + + GSA
Sbjct: 158 KTFNAKSYQNSKKSVTPPRPKQPSEKNKRATSFSNENRNSSSVPLAKNQAKKTANSGSAV 217

Query: 356 RRNSRIASNGRGTFPNFVSS 415
SRI+S+G + N S+
Sbjct: 218 GSESRISSSGSESSSNVNSA 237


>sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial
OS=Neurospora crassa GN=mip-1 PE=3 SV=2
Length = 1456

Score = 30.4 bits (67), Expect = 5.3
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = -1

Query: 351 AEPIWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLK 229
+E +WIAS+ + +F++H GNA+G F LEG K
Sbjct: 743 SEELWIASV------VGDATFKLHGGNAIG---FMTLEGTK 774


>sp|Q2SL23|CAPP_HAHCH Phosphoenolpyruvate carboxylase OS=Hahella
chejuensis (strain KCTC 2396) GN=ppc PE=3 SV=1
Length = 881

Score = 30.0 bits (66), Expect = 6.9
Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 5/46 (10%)
Frame = -2

Query: 212 STLLEEEHSRAFLRL-----SAWLTDEDRQAVHNAVMQLKLGFEVV 90
S LL+EE+++ RL AW TDE R AV + K GF V+
Sbjct: 168 SDLLDEEYAKIVERLRRLITEAWHTDEIRYERPTAVDEAKWGFAVI 213


>sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya
gossypii GN=BEM2 PE=4 SV=1
Length = 2071

Score = 30.0 bits (66), Expect = 6.9
Identities = 17/44 (38%), Positives = 22/44 (50%)
Frame = +2

Query: 215 SAISPFKPSNSVKNFDPTAFPAWT*KLSSAKFCKSSSIEAIQIG 346
SA FKPS +D FP W K++S + C + IQIG
Sbjct: 1064 SASGIFKPS-----YDELKFPVWDLKVTSVEGCPLDYLAKIQIG 1102


>sp|Q17RH7|TPRXL_HUMAN Putative protein TPRXL OS=Homo sapiens
GN=TPRXL PE=2 SV=1
Length = 257

Score = 24.3 bits (51), Expect(2) = 7.5
Identities = 26/107 (24%), Positives = 46/107 (42%), Gaps = 4/107 (3%)
Frame = +2

Query: 188 NAPPQVEYSSAISPFK----PSNSVKNFDPTAFPAWT*KLSSAKFCKSSSIEAIQIGSAT 355
++P SS+ SP PS+S + ++ + SS+ SSS + S++
Sbjct: 133 SSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSS 192

Query: 356 RRNSRIASNGRGTFPNFVSSGSPLPWKSEPPSFKS*KVSAKATNPLA 496
+S + + R + P+ SS + P S P S S ++ P A
Sbjct: 193 PSSSSSSPSPRSSSPSSSSSSTSSPSTSSPSSSSPSSSSPSSSCPSA 239



Score = 23.5 bits (49), Expect(2) = 7.5
Identities = 15/41 (36%), Positives = 23/41 (56%)
Frame = +1

Query: 82 SSDTTSNPSFSCITALCTACLSSSVNHAESLRKALECSSSS 204
SS ++S+PS S T+ ++ SSS + S + SSSS
Sbjct: 76 SSHSSSSPSSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSS 116


tr_hit_id A9NRF4
Definition tr|A9NRF4|A9NRF4_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 109
Score (bit) 112.0
E-value 3.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915812|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_C06.
(522 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NRF4|A9NRF4_PICSI Putative uncharacterized protein OS=Picea... 112 3e-30
tr|Q9ZQI9|Q9ZQI9_ARATH Expressed protein OS=Arabidopsis thaliana... 87 8e-18
tr|Q941B8|Q941B8_ARATH At2g13860/F13J11.19 OS=Arabidopsis thalia... 87 8e-18
tr|Q10QM0|Q10QM0_ORYSJ Os03g0192000 protein OS=Oryza sativa subs... 92 2e-17
tr|A3AF06|A3AF06_ORYSJ Putative uncharacterized protein OS=Oryza... 92 2e-17
tr|B8AQ44|B8AQ44_ORYSI Putative uncharacterized protein OS=Oryza... 91 5e-17
tr|B6T490|B6T490_MAIZE Protein trpH OS=Zea mays PE=2 SV=1 89 1e-16
tr|A7QGP0|A7QGP0_VITVI Chromosome chr12 scaffold_93, whole genom... 86 1e-16
tr|Q6Z8I4|Q6Z8I4_ORYSJ Putative PHP domain N-terminal region:PHP... 88 2e-16
tr|A2X9P6|A2X9P6_ORYSI Putative uncharacterized protein OS=Oryza... 88 2e-16
tr|A9T7Y2|A9T7Y2_PHYPA Predicted protein (Fragment) OS=Physcomit... 60 9e-08
tr|Q3Z644|Q3Z644_DEHE1 PHP domain N-terminal region family prote... 38 0.35
tr|A8CPQ7|A8CPQ7_9CHLR PHP C-terminal domain protein OS=Dehaloco... 38 0.35
tr|Q8PPD4|Q8PPD4_XANAC Thiamine-monophosphate kinase OS=Xanthomo... 37 0.46
tr|Q3BXH8|Q3BXH8_XANC5 Thiamine-phosphate kinase OS=Xanthomonas ... 37 0.46
tr|Q3ZW80|Q3ZW80_DEHSC PHP domain N-terminal region family prote... 37 0.60
tr|A5FPE6|A5FPE6_DEHSB PHP C-terminal domain protein OS=Dehaloco... 37 0.60
tr|B1GYL6|B1GYL6_UNCTG Putative metal-dependent phosphoesterase ... 36 1.0
tr|B4SDS8|B4SDS8_PELPB PHP domain protein OS=Pelodictyon phaeocl... 36 1.3
tr|Q4FX62|Q4FX62_LEIMA Proteophosphoglycan 5 OS=Leishmania major... 33 1.6
tr|A9V1U7|A9V1U7_MONBE Predicted protein OS=Monosiga brevicollis... 35 1.7
tr|B8ME59|B8ME59_9EURO Protein kinase, putative OS=Talaromyces s... 35 1.7
tr|Q5GW17|Q5GW17_XANOR Thiamine-monophosphate kinase OS=Xanthomo... 35 2.3
tr|Q2NZ93|Q2NZ93_XANOM Thiamine-monophosphate kinase OS=Xanthomo... 35 2.3
tr|B2SNW6|B2SNW6_XANOP Thiamine-monophosphate kinase OS=Xanthomo... 35 2.3
tr|A4SDF4|A4SDF4_PROVI PHP C-terminal domain protein OS=Prosthec... 35 2.3
tr|Q0YUN9|Q0YUN9_9CHLB PHP-like OS=Chlorobium ferrooxidans DSM 1... 35 2.3
tr|Q4FX63|Q4FX63_LEIMA Proteophosphoglycan ppg4 OS=Leishmania ma... 32 2.8
tr|Q3B5Q0|Q3B5Q0_PELLD Phosphoesterase PHP-like OS=Pelodictyon l... 35 3.0
tr|A7F3R4|A7F3R4_SCLS1 Predicted protein OS=Sclerotinia scleroti... 34 3.8

>tr|A9NRF4|A9NRF4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 332

Score = 112 bits (281), Expect(2) = 3e-30
Identities = 60/109 (55%), Positives = 76/109 (69%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGKA GF LAD +QLLKLGGSDFHGRG PDET LGKV +P A+ EFL+VA+P
Sbjct: 182 IEVYRSDGKAAGFHELADAYQLLKLGGSDFHGRGGPDETDLGKVNIPDSAMHEFLKVAQP 241

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKGDIALEYST*G 196
IW +I+ +L +FAEE+ A+G F + + LKGD+ L + G
Sbjct: 242 IWHDAIKNILLSFAEET------KAIGFDSFGKYKCLKGDMHLRNNALG 284



Score = 42.4 bits (98), Expect(2) = 3e-30
Identities = 22/55 (40%), Positives = 35/55 (63%)
Frame = -2

Query: 218 RSSTLLEEEHSRAFLRLSAWLTDEDRQAVHNAVMQLKLGFEVVSEDGRTTCIVSR 54
R++ L ++E A L LS+WLT E+R V ++LKL + V+ + G+ T +VSR
Sbjct: 279 RNNALGDKEEIVA-LHLSSWLTKEERVTVEEEAIKLKLSYTVICDKGKETSVVSR 332


>tr|Q9ZQI9|Q9ZQI9_ARATH Expressed protein OS=Arabidopsis thaliana
GN=At2g13840 PE=2 SV=2
Length = 434

Score = 86.7 bits (213), Expect(2) = 8e-18
Identities = 44/102 (43%), Positives = 65/102 (63%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK F LADT+ LLKLGGSD+HG+G +E++LG V LP+ A+++FL V P
Sbjct: 287 VEVYRSDGKLEVFSELADTYNLLKLGGSDYHGKGGRNESELGSVNLPVTALQDFLNVGRP 346

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKGDIA 217
IW +I+ ++ F ++ + N + F + LKG+ A
Sbjct: 347 IWCEAIKATMRAFLDQPSDSNLSNILR---FDKARILKGNSA 385



Score = 26.6 bits (57), Expect(2) = 8e-18
Identities = 12/36 (33%), Positives = 21/36 (58%)
Frame = -2

Query: 170 LSAWLTDEDRQAVHNAVMQLKLGFEVVSEDGRTTCI 63
L+ WLT ++R + ++LKL F + +G TC+
Sbjct: 397 LAIWLTSDERNSNDFEALRLKLSFVPIMSNG--TCV 430


>tr|Q941B8|Q941B8_ARATH At2g13860/F13J11.19 OS=Arabidopsis thaliana
PE=2 SV=1
Length = 433

Score = 86.7 bits (213), Expect(2) = 8e-18
Identities = 44/102 (43%), Positives = 65/102 (63%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK F LADT+ LLKLGGSD+HG+G +E++LG V LP+ A+++FL V P
Sbjct: 286 VEVYRSDGKLEVFSELADTYNLLKLGGSDYHGKGGRNESELGSVNLPVTALQDFLNVGRP 345

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKGDIA 217
IW +I+ ++ F ++ + N + F + LKG+ A
Sbjct: 346 IWCEAIKATMRAFLDQPSDSNLSNILR---FDKARILKGNSA 384



Score = 26.6 bits (57), Expect(2) = 8e-18
Identities = 12/36 (33%), Positives = 21/36 (58%)
Frame = -2

Query: 170 LSAWLTDEDRQAVHNAVMQLKLGFEVVSEDGRTTCI 63
L+ WLT ++R + ++LKL F + +G TC+
Sbjct: 396 LAIWLTSDERNSNDFEALRLKLSFVPIMSNG--TCV 429


>tr|Q10QM0|Q10QM0_ORYSJ Os03g0192000 protein OS=Oryza sativa subsp.
japonica GN=Os03g0192000 PE=4 SV=1
Length = 429

Score = 92.0 bits (227), Expect = 2e-17
Identities = 45/99 (45%), Positives = 63/99 (63%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK +GF LA+ + LLK+GGSDFHGRG DE+ +G V L + + FL++A P
Sbjct: 291 LEVYRSDGKVDGFSELAEKYDLLKIGGSDFHGRGGKDESDIGTVKLAITTLCSFLKMARP 350

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKG 226
IW ++++++L FAEE + G V F EL G
Sbjct: 351 IWCSAMKDILLKFAEEPSTTNLGKMV---LFGELINFNG 386


>tr|A3AF06|A3AF06_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009378 PE=4 SV=1
Length = 423

Score = 92.0 bits (227), Expect = 2e-17
Identities = 45/99 (45%), Positives = 63/99 (63%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK +GF LA+ + LLK+GGSDFHGRG DE+ +G V L + + FL++A P
Sbjct: 291 LEVYRSDGKVDGFSELAEKYDLLKIGGSDFHGRGGKDESDIGTVKLAITTLCSFLKMARP 350

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKG 226
IW ++++++L FAEE + G V F EL G
Sbjct: 351 IWCSAMKDILLKFAEEPSTTNLGKMV---LFGELINFNG 386


>tr|B8AQ44|B8AQ44_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10344 PE=4 SV=1
Length = 429

Score = 90.5 bits (223), Expect = 5e-17
Identities = 44/99 (44%), Positives = 62/99 (62%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK +GF LA+ + LLK+GGSDFHGRG DE+ +G V L + + FL++A P
Sbjct: 291 LEVYRSDGKVDGFSELAEKYDLLKIGGSDFHGRGGKDESDIGTVKLAITTLCSFLKMARP 350

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEGLKG 226
IW ++++++L F EE + G V F EL G
Sbjct: 351 IWCSAMKDILLKFTEEPSTTNLGKMV---MFGELINFNG 386


>tr|B6T490|B6T490_MAIZE Protein trpH OS=Zea mays PE=2 SV=1
Length = 416

Score = 89.4 bits (220), Expect = 1e-16
Identities = 44/96 (45%), Positives = 62/96 (64%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
MEVYR DG+ NGF LA+ + LLKLGGSDFHGRG DE+ +G V L + + FL++A
Sbjct: 280 MEVYRSDGEVNGFSELAEKYGLLKLGGSDFHGRGGKDESDVGTVKLAITTLCCFLKMARS 339

Query: 342 IWIASIEELLQNFAEESFQVHAGNAVGSKFFTELEG 235
IW ++++++L FAEE + GN + T+ G
Sbjct: 340 IWSSAMKDILLKFAEEPSAANLGNMLKFGRLTKFAG 375


>tr|A7QGP0|A7QGP0_VITVI Chromosome chr12 scaffold_93, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00038415001
PE=4 SV=1
Length = 406

Score = 86.3 bits (212), Expect(2) = 1e-16
Identities = 39/76 (51%), Positives = 55/76 (72%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK + LAD + L+KLGGSD+HGRG E+ LG V LP+LA+ +FL+VA P
Sbjct: 263 IEVYRSDGKLAAYNDLADDYGLVKLGGSDYHGRGGQGESDLGSVNLPVLAVHDFLKVARP 322

Query: 342 IWIASIEELLQNFAEE 295
IW +I +L+++ +E
Sbjct: 323 IWCNAIRNILESYIKE 338



Score = 23.1 bits (48), Expect(2) = 1e-16
Identities = 10/23 (43%), Positives = 16/23 (69%)
Frame = -2

Query: 176 LRLSAWLTDEDRQAVHNAVMQLK 108
L L++WLT+E+RQ ++LK
Sbjct: 371 LCLTSWLTNEERQNPEFEAIKLK 393


>tr|Q6Z8I4|Q6Z8I4_ORYSJ Putative PHP domain N-terminal region:PHP
domain C-terminal region (Putative uncharacterized
protein) OS=Oryza sativa subsp. japonica GN=P0431B06.47
PE=4 SV=1
Length = 444

Score = 88.2 bits (217), Expect = 2e-16
Identities = 41/77 (53%), Positives = 54/77 (70%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK +G LADT+ LLK+GGSD+HGR D DE +G V LP+LA+ FL A+P
Sbjct: 320 IEVYRSDGKLSGLSDLADTYGLLKIGGSDYHGRDDKDEPDVGSVDLPVLAVSGFLDAAQP 379

Query: 342 IWIASIEELLQNFAEES 292
IW + +E+L N E +
Sbjct: 380 IWHNATKEILANITERA 396


>tr|A2X9P6|A2X9P6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08967 PE=4 SV=1
Length = 444

Score = 88.2 bits (217), Expect = 2e-16
Identities = 41/77 (53%), Positives = 54/77 (70%)
Frame = -1

Query: 522 MEVYRGDGKANGFVALADTFQLLKLGGSDFHGRGDPDETKLGKVPLPLLAIREFLRVAEP 343
+EVYR DGK +G LADT+ LLK+GGSD+HGR D DE +G V LP+LA+ FL A+P
Sbjct: 320 IEVYRSDGKLSGLSDLADTYGLLKIGGSDYHGRDDKDEPDVGSVDLPVLAVSGFLDAAQP 379

Query: 342 IWIASIEELLQNFAEES 292
IW + +E+L N E +
Sbjct: 380 IWHNATKEILANITERA 396