BP915814
Clone id YMU001_000077_C09
Library
Length 525
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000077_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCCAAAGAAGATGTTACATGGTTACGGTAGGAAAAATAAATTTGTTGGTGTCCATGACTA
CCTTCCATTCCAGTTAGATGTCGCCAATTGATGACTGTTGTGAGAATTGTGGTCAGCAAG
GAAACAATACAGGAATCCTATAAACACTTGATGAATGAACTGAACAGGTGGGAATGAGCG
AGCCAAGGTGGCTGACGTCCCCATTATTTTGAAGACCAGCAATCGATCGGGGTCTCCACA
TCAATGAGAGGTCAAATTGTTAGTCTGTGTGTCTGAAGCCATCGTTGTTTGATCGGTCAG
CCAAATCACCATGCACAAACGGTATGTATGGACACTAGTTTACATGGAGGAGAGGATGTA
CAGATATGTTGGGAGAGGGGCCTAAACATTTCTACACTTTACAGATGCGGCATATGCGCA
CACAAGAGCATCTCTGAGCTTCTGGCAAGCTTAAAAAACCTTGGTTTCCATAAATTGCTG
CTTGGCCTGTTGTGCGGTCCAATAAGAATGCGCTTGTATGACGCG
■■Homology search results ■■ -
sp_hit_id O00400
Definition sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens
Align length 100
Score (bit) 33.1
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915814|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_C09.
(525 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sa... 33 0.84
sp|O01975|YJ05_CAEEL Uncharacterized protein C41D11.5 OS=Caenorh... 32 1.8
sp|O32591|ESPP_ECOLX Serine protease espP OS=Escherichia coli GN... 31 4.1
sp|Q7BSW5|ESPP_ECO57 Serine protease espP OS=Escherichia coli O1... 31 4.1
sp|Q5AEI2|ATG10_CANAL Autophagy-related protein 10 OS=Candida al... 30 5.3
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus mus... 30 5.4

>sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo
sapiens GN=SLC33A1 PE=1 SV=1
Length = 549

Score = 33.1 bits (74), Expect = 0.84
Identities = 25/100 (25%), Positives = 42/100 (42%)
Frame = -1

Query: 369 TYLYILSSM*TSVHTYRLCMVIWLTDQTTMASDTQTNNLTSH*CGDPDRLLVFKIMGTSA 190
TY+ +L+++ + + +WL D T+ +N C PD + + K +G S
Sbjct: 447 TYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQN---CRTPDAVELCKKLGGSC 503

Query: 189 TLARSFPPVQFIHQVFIGFLYCFLADHNSHNSHQLATSNW 70
A V+ I VFIGF + F +S+W
Sbjct: 504 VTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGSSSW 543


>sp|O01975|YJ05_CAEEL Uncharacterized protein C41D11.5
OS=Caenorhabditis elegans GN=C41D11.5 PE=2 SV=2
Length = 238

Score = 32.0 bits (71), Expect = 1.8
Identities = 18/50 (36%), Positives = 25/50 (50%)
Frame = -3

Query: 229 RSIAGLQNNGDVSHLGSLIPTCSVHSSSVYRIPVLFPC*PQFSQQSSIGD 80
R I + G+VS + I TC V S+ YR+P+ C + S S GD
Sbjct: 87 REIFRSHHRGNVSEVAIFIGTCPVRSTYSYRVPITI-CEAEDSTHKSCGD 135


>sp|O32591|ESPP_ECOLX Serine protease espP OS=Escherichia coli
GN=espP PE=1 SV=1
Length = 1300

Score = 30.8 bits (68), Expect = 4.1
Identities = 12/24 (50%), Positives = 14/24 (58%)
Frame = -1

Query: 141 IGFLYCFLADHNSHNSHQLATSNW 70
IG Y A HN+ N H +AT NW
Sbjct: 117 IGGAYSITATHNTKNHHSVATQNW 140


>sp|Q7BSW5|ESPP_ECO57 Serine protease espP OS=Escherichia coli
O157:H7 GN=espP PE=1 SV=1
Length = 1300

Score = 30.8 bits (68), Expect = 4.1
Identities = 12/24 (50%), Positives = 14/24 (58%)
Frame = -1

Query: 141 IGFLYCFLADHNSHNSHQLATSNW 70
IG Y A HN+ N H +AT NW
Sbjct: 117 IGGAYSITATHNTKNHHSVATQNW 140


>sp|Q5AEI2|ATG10_CANAL Autophagy-related protein 10 OS=Candida
albicans GN=ATG10 PE=3 SV=1
Length = 177

Score = 30.4 bits (67), Expect = 5.3
Identities = 17/41 (41%), Positives = 21/41 (51%)
Frame = -3

Query: 475 IYGNQGFLSLPEAQRCSCVRICRICKV*KCLGPSPNISVHP 353
+Y N FL+ P AQR V ICR+ L P + VHP
Sbjct: 78 LYDNDTFLTSPMAQRTLAVGICRVDLHNHHLLQQPWLQVHP 118


>sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus
musculus GN=Slc33a1 PE=1 SV=1
Length = 550

Score = 30.4 bits (67), Expect = 5.4
Identities = 24/100 (24%), Positives = 40/100 (40%)
Frame = -1

Query: 369 TYLYILSSM*TSVHTYRLCMVIWLTDQTTMASDTQTNNLTSH*CGDPDRLLVFKIMGTSA 190
TY+ +L+++ + + +WL D T+ +N C PD + + K +G S
Sbjct: 448 TYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQN---CRTPDAIELCKKLGGSC 504

Query: 189 TLARSFPPVQFIHQVFIGFLYCFLADHNSHNSHQLATSNW 70
A V+ I V IGF + F S+W
Sbjct: 505 VTALDGYYVESIICVLIGFGWWFFLGPKFKKLQDEGPSSW 544


tr_hit_id A3VBM8
Definition tr|A3VBM8|A3VBM8_9RHOB Aspartate-semialdehyde dehydrogenase OS=Rhodobacterales bacterium HTCC2654
Align length 54
Score (bit) 34.3
E-value 3.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915814|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_C09.
(525 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3VBM8|A3VBM8_9RHOB Aspartate-semialdehyde dehydrogenase OS=R... 34 3.9
tr|B2R5Q2|B2R5Q2_HUMAN Solute carrier family 33 (Acetyl-CoA tran... 33 8.8

>tr|A3VBM8|A3VBM8_9RHOB Aspartate-semialdehyde dehydrogenase
OS=Rhodobacterales bacterium HTCC2654 GN=RB2654_16866
PE=3 SV=1
Length = 340

Score = 34.3 bits (77), Expect = 3.9
Identities = 19/54 (35%), Positives = 26/54 (48%)
Frame = -3

Query: 184 GSLIPTCSVHSSSVYRIPVLFPC*PQFSQQSSIGDI*LEWKVVMDTNKFIFPTV 23
G +P V S VY + F C PQ GD EWK+V +T K + P++
Sbjct: 176 GMFVPGQEVEPS-VYPKQIAFNCIPQIDVFMDSGDTKEEWKMVTETKKIVDPSI 228


>tr|B2R5Q2|B2R5Q2_HUMAN Solute carrier family 33 (Acetyl-CoA
transporter), member 1, isoform CRA_a OS=Homo sapiens
GN=SLC33A1 PE=2 SV=1
Length = 549

Score = 33.1 bits (74), Expect = 8.8
Identities = 25/100 (25%), Positives = 42/100 (42%)
Frame = -1

Query: 369 TYLYILSSM*TSVHTYRLCMVIWLTDQTTMASDTQTNNLTSH*CGDPDRLLVFKIMGTSA 190
TY+ +L+++ + + +WL D T+ +N C PD + + K +G S
Sbjct: 447 TYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQN---CRTPDAVELCKKLGGSC 503

Query: 189 TLARSFPPVQFIHQVFIGFLYCFLADHNSHNSHQLATSNW 70
A V+ I VFIGF + F +S+W
Sbjct: 504 VTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGSSSW 543