BP915845
Clone id YMU001_000077_G12
Library
Length 498
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000077_G12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTAGCCTCCGCATGGTGTTCTTCCCCAGCTTCATGCATCTTCAGCACGAAATCACTCTC
TCTAGGTTTCATAGCTGCCTGTTCAAAGGCCCCATGCCTGAGATAGGCACTGTGTACCGT
CCAGAAACCTTCTGGACCCTTCCATCAGACAGGCTTCCCATCAGCAGCAGCTTGAAAAGC
CGTGTCTCGTTCATTGAAACTAGTTTCCTGGCAAATTGTAACTCGATTTGTATCAGTAGA
TTCAGGCCCATCTTGCAAAATAGTTGCATCACAACTTTGATAACCTGCTGAATTATTGGC
TGAATCACTACAAACTGCACTTTCTTCTCTGTTGTCATCCCTTGGAAAGAAGGATTGAGT
AGACTCATCTGGGCCTAACATATTAATGTCCTGAGCCTTGGTGGACTTGACGTCATCGTG
CACACTCTTTTCTTCTAAATCAGCACATTCACCACTACCATTGGATCTGTCAGATGAGGA
TTGGTCTATCCCATCAAC
■■Homology search results ■■ -
sp_hit_id Q9NZW4
Definition sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens
Align length 96
Score (bit) 39.7
E-value 0.008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915845|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_G12.
(498 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens ... 40 0.008
sp|P97399|DSPP_MOUSE Dentin sialophosphoprotein OS=Mus musculus ... 39 0.013
sp|Q62598|DSPP_RAT Dentin sialophosphoprotein OS=Rattus norvegic... 36 0.087
sp|Q9P785|YNY5_SCHPO LisH domain-containing protein C1711.05 OS=... 35 0.25
sp|O80297|COATA_BPIF1 Coat protein A OS=Enterobacteria phage If1... 34 0.33
sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo sa... 32 1.6
sp|Q5K4E3|POLS2_HUMAN Polyserase-2 OS=Homo sapiens GN=PRSS36 PE=... 32 2.1
sp|Q60438|CREL2_CRIGR Cysteine-rich with EGF-like domain protein... 32 2.1
sp|Q49ZU4|Y535_STAS1 Uncharacterized lipoprotein SSP0535 OS=Stap... 31 2.8
sp|P32583|SRP40_YEAST Suppressor protein SRP40 OS=Saccharomyces ... 31 2.8
sp|Q6CQ86|RT106_KLULA Histone chaperone RTT106 OS=Kluyveromyces ... 31 2.8
sp|Q868Z9|PPN_DROME Papilin OS=Drosophila melanogaster GN=Ppn PE... 31 2.8
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyo... 30 4.8
sp|Q74ZJ8|SEC16_ASHGO COPII coat assembly protein SEC16 OS=Ashby... 30 6.3
sp|Q5RC28|PRCM_PONAB Probable proline racemase OS=Pongo abelii P... 30 8.0
sp|P21849|TSA4_GIALA Major surface-labeled trophozoite antigen 4... 30 8.2
sp|Q7ZX41|GNL3_XENLA Guanine nucleotide-binding protein-like 3 O... 30 8.2

>sp|Q9NZW4|DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens
GN=DSPP PE=1 SV=2
Length = 1301

Score = 39.7 bits (91), Expect = 0.008
Identities = 25/96 (26%), Positives = 49/96 (51%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S+S S+ S + +D + + D S+ + D + +S+ S D + +S+ S
Sbjct: 802 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSS--NSSDSSDSSDSSDGSDSDSSNRS 859

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+N+S S D++ D +S+D+N + ++S
Sbjct: 860 DSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSS 895



Score = 38.5 bits (88), Expect = 0.018
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 769 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 827

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 828 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 858



Score = 37.4 bits (85), Expect = 0.039
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 691 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 749

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 750 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 808



Score = 37.4 bits (85), Expect = 0.039
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 1143 DSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 1202

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 1203 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 1241



Score = 35.0 bits (79), Expect = 0.19
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 594 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 651

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 652 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 706



Score = 31.6 bits (70), Expect = 2.1
Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 5/95 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDIN-MLGPDESTQSFFPRDDNREE- 322
D D S S+ S+ S + +D S D S+ + D + +S++S D++
Sbjct: 878 DSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSD 937

Query: 321 ---SAVCSDSANNSAGYQSCDATILQDGPESTDTN 226
S+ SDS+++S S +++ + +S+D+N
Sbjct: 938 SSNSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSN 972


>sp|P97399|DSPP_MOUSE Dentin sialophosphoprotein OS=Mus musculus
GN=Dspp PE=1 SV=2
Length = 934

Score = 38.9 bits (89), Expect = 0.013
Identities = 28/112 (25%), Positives = 54/112 (48%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D SSS S+ S C+D + S D S+ + D + +S+ S N +S+
Sbjct: 638 DSSDSSSSSDSSDSSSCSDSSDSS--DSSDSSDSSDSSDSSSSDSSSS-----SNSSDSS 690

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+++S S D++ D S+D++ + ++S + + +++D
Sbjct: 691 DSSDSSSSSDSSDSSDSSDSSDSSGSSDSSDSSASSDSSSSSDSSDSSSSSD 742



Score = 34.7 bits (78), Expect = 0.25
Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRD--DNREESAV 313
+ SSD S+G G+ + + D +S + + D S+ S D D+ ++S+
Sbjct: 502 EDDSSDDSSGDGD----SDSNGDGDSESEDKDESDSSDHDNSSDSESKSDSSDSSDDSSD 557

Query: 312 CSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 558 SSDSSDSSDSSDSSDSSDSSDSSDSSDSNSSSDSSDSS 595



Score = 34.3 bits (77), Expect = 0.33
Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 14/103 (13%)
Frame = -1

Query: 495 DGIDQSSSDR---SNGSG----ECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRD 337
D D SS D SNG G E D + S HD+ ++++ + D+S+ S D
Sbjct: 504 DSSDDSSGDGDSDSNGDGDSESEDKDESDSSDHDNSSDSESKSDSSDSSDDSSDSSDSSD 563

Query: 336 DN-------REESAVCSDSANNSAGYQSCDATILQDGPESTDT 229
+ +S+ SDS+++++ S D++ D +S+DT
Sbjct: 564 SSDSSDSSDSSDSSDSSDSSDSNSSSDSSDSSGSSDSSDSSDT 606



Score = 32.0 bits (71), Expect = 1.6
Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 8/115 (6%)
Frame = -1

Query: 498 VDGIDQSSSDRSNGSGECADLEEKSVHD-----DVKSTKAQDINMLGPDESTQSFFPRDD 334
+ G D SSD SNGS E +D +S ++ D T + + D + S DD
Sbjct: 449 MQGDDPKSSDESNGSDE-SDTNSESANESGSRGDASYTSDESSD---DDNDSDSHAGEDD 504

Query: 333 NREESAVCSDSANNSAG---YQSCDATILQDGPESTDTNRVTICQETSFNERDTA 178
+ ++S+ DS +N G + D + D S+D+ + ++S + D++
Sbjct: 505 SSDDSSGDGDSDSNGDGDSESEDKDESDSSDHDNSSDSESKSDSSDSSDDSSDSS 559



Score = 29.6 bits (65), Expect = 8.2
Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
Frame = -1

Query: 486 DQSSSDRSNG---SGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D+SS D ++ +GE ++ S D S D DES S + E +
Sbjct: 487 DESSDDDNDSDSHAGEDDSSDDSSGDGDSDSNGDGDSESEDKDESDSSDHDNSSDSESKS 546

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTN 226
SDS+++S+ S D++ D +S+D++
Sbjct: 547 DSSDSSDDSS--DSSDSSDSSDSSDSSDSS 574


>sp|Q62598|DSPP_RAT Dentin sialophosphoprotein OS=Rattus norvegicus
GN=Dspp PE=1 SV=2
Length = 687

Score = 36.2 bits (82), Expect = 0.087
Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 6/112 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNRE--- 325
D + SD + +GE ++ S DD S D DES S D + E
Sbjct: 484 DESSDNGSDSDSHAGEDDSSDDTSDTDDSDSNGDDDSESKDKDESDNSNHDNDSDSESKS 543

Query: 324 -ESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQET--SFNERDTA 178
S SDS+++S S D++ D +S+DT+ + ++ S N DT+
Sbjct: 544 DSSDSDSDSSDSSDSSDSSDSSETSDSSDSSDTSDSSDSSDSSDSSNSSDTS 595



Score = 32.0 bits (71), Expect = 1.6
Identities = 26/114 (22%), Positives = 53/114 (46%), Gaps = 5/114 (4%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNRE-----E 322
D S +D S+ +G+ D E K + S D + +S+ S D+ + +
Sbjct: 505 DTSDTDDSDSNGD-DDSESKDKDESDNSNHDNDSDSESKSDSSDSDSDSSDSSDSSDSSD 563

Query: 321 SAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
S+ SDS+++S S D++ D S+DT+ + + ++ D++ ++D
Sbjct: 564 SSETSDSSDSSDTSDSSDSSDSSDSSNSSDTSDSSDSSDGDSSDGDSSDSDSSD 617


>sp|Q9P785|YNY5_SCHPO LisH domain-containing protein C1711.05
OS=Schizosaccharomyces pombe GN=SPBC1711.05 PE=2 SV=1
Length = 451

Score = 34.7 bits (78), Expect = 0.25
Identities = 26/89 (29%), Positives = 41/89 (46%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D +SSS+ S+ S +D E +S S+K D + D S D+ ES+
Sbjct: 242 DSESESSSEDSDSSSSSSDSESES------SSKDSDSSSNSSDSEDDSSSDSSDSESESS 295

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDT 229
DS + S+ S ++ +DG +TDT
Sbjct: 296 -SEDSDSTSSSSDSDSSSSSEDGNSNTDT 323


>sp|O80297|COATA_BPIF1 Coat protein A OS=Enterobacteria phage If1
GN=III PE=3 SV=1
Length = 460

Score = 34.3 bits (77), Expect = 0.33
Identities = 29/117 (24%), Positives = 45/117 (38%), Gaps = 1/117 (0%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
DG D S+G G D S D V T Q +N+ P + + P + + +S
Sbjct: 78 DGSGNGGDDNSSGGGSNGDSGNNSTPDTV--TPGQTVNL--PSDLSTLSIPANVVKSDSI 133

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAF-QAAADGKPV 148
S +A C L + +S +T + +N+ D F Q +DG V
Sbjct: 134 GSQFSLYTNASCTMCSGYYLSNNADSIAIANITETVKADYNQPDMWFEQTDSDGNHV 190


>sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo
sapiens GN=ACRC PE=2 SV=1
Length = 691

Score = 32.0 bits (71), Expect = 1.6
Identities = 21/69 (30%), Positives = 35/69 (50%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D SS D S+ S + + S DV K+ D ++ PD+S+ DD+ ++S
Sbjct: 191 DNSDDSSDDNSDDSSD-----DNSDDSDVPDDKSDDSDV--PDDSSDDSDVPDDSSDDSE 243

Query: 315 VCSDSANNS 289
DS+++S
Sbjct: 244 APDDSSDDS 252


>sp|Q5K4E3|POLS2_HUMAN Polyserase-2 OS=Homo sapiens GN=PRSS36 PE=1
SV=2
Length = 855

Score = 31.6 bits (70), Expect = 2.1
Identities = 11/24 (45%), Positives = 13/24 (54%)
Frame = -3

Query: 160 WEACLMEGSRRFLDGTQCLSQAWG 89
W CL S RF+ GT C + WG
Sbjct: 156 WPVCLPRASHRFVHGTACWATGWG 179


>sp|Q60438|CREL2_CRIGR Cysteine-rich with EGF-like domain protein 2
OS=Cricetulus griseus GN=CRELD2 PE=2 SV=1
Length = 348

Score = 31.6 bits (70), Expect = 2.1
Identities = 21/72 (29%), Positives = 32/72 (44%)
Frame = -1

Query: 474 SDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCSDSAN 295
S S GECAD++E S+ + K K ++ N S P + +C+DS
Sbjct: 278 SGYSKQKGECADIDECSL--ETKVCKKENENCYNTPGSFVCVCPEGFEEDRRCLCTDSRR 335

Query: 294 NSAGYQSCDATI 259
S +S AT+
Sbjct: 336 RSGRGKSHTATL 347


>sp|Q49ZU4|Y535_STAS1 Uncharacterized lipoprotein SSP0535
OS=Staphylococcus saprophyticus subsp. saprophyticus
(strain ATCC 15305 / DSM 20229) GN=SSP0535 PE=4 SV=1
Length = 274

Score = 31.2 bits (69), Expect = 2.8
Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 12/100 (12%)
Frame = -1

Query: 486 DQSSSDRSNGSGE-----------CADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPR 340
D SSSDR+NG E + + + + D S+ A N G +++ +
Sbjct: 76 DSSSSDRNNGDDENSSDNASGSDSSSSNNDSNANSDGSSSNADGDNASGNNDNANNATSS 135

Query: 339 DDNREESAVCSD-SANNSAGYQSCDATILQDGPESTDTNR 223
+ N E+ +D + +NS S DA +G S +T++
Sbjct: 136 ESNGNENGAMNDANGSNSNDNASADA---NNGASSANTSQ 172


>sp|P32583|SRP40_YEAST Suppressor protein SRP40 OS=Saccharomyces
cerevisiae GN=SRP40 PE=1 SV=2
Length = 406

Score = 31.2 bits (69), Expect = 2.8
Identities = 24/99 (24%), Positives = 43/99 (43%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D SSS S+ S +D + S D S+ + + DEST S D+ +S S
Sbjct: 222 DSSSSSSSSSSDSDSDSDSSSDSDSSGSSDSSSSSDSSSDESTSSDSSDSDSDSDSGSSS 281

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNE 190
+ A + D + ++ P S++ + + +S N+
Sbjct: 282 ELETKEA---TADESKAEETPASSNESTPSASSSSSANK 317


tr_hit_id B7SEW6
Definition tr|B7SEW6|B7SEW6_HUMAN Dentin sialophosphoprotein (Fragment) OS=Homo sapiens
Align length 112
Score (bit) 42.7
E-value 0.009
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915845|Adiantum capillus-veneris mRNA, clone:
YMU001_000077_G12.
(498 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7SEW6|B7SEW6_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 43 0.009
tr|B7SEX1|B7SEX1_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 40 0.061
tr|B7SEY4|B7SEY4_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 40 0.079
tr|B7SEX4|B7SEX4_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 40 0.079
tr|B7SEX2|B7SEX2_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 40 0.079
tr|B7SEZ0|B7SEZ0_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.14
tr|B7SEY5|B7SEY5_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.14
tr|B7SEY2|B7SEY2_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.18
tr|B7SEY1|B7SEY1_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.18
tr|B7SEX9|B7SEX9_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.18
tr|B7SEX8|B7SEX8_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.18
tr|B7SEW5|B7SEW5_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 39 0.18
tr|Q8VBY1|Q8VBY1_RAT Dentin sialoprotein-phosphophoryn OS=Rattus... 38 0.23
tr|B7SEZ7|B7SEZ7_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 38 0.23
tr|B7SEZ5|B7SEZ5_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 38 0.23
tr|B7SEY7|B7SEY7_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 38 0.23
tr|B7SEX7|B7SEX7_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 38 0.23
tr|B7SEX5|B7SEX5_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 38 0.23
tr|B6LB40|B6LB40_BRAFL Putative uncharacterized protein OS=Branc... 38 0.30
tr|Q4XNF5|Q4XNF5_PLACH Putative uncharacterized protein (Fragmen... 37 0.39
tr|B8QTP3|B8QTP3_HUMAN Dentin sialophosphoprotein variant E (Fra... 37 0.39
tr|B7SFD5|B7SFD5_HUMAN Dentin sialophosphoprotein variant D (Fra... 37 0.39
tr|B7SF13|B7SF13_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SF10|B7SF10_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SF09|B7SF09_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SF03|B7SF03_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SEZ4|B7SEZ4_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SEZ1|B7SEZ1_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SEY3|B7SEY3_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39
tr|B7SEY0|B7SEY0_HUMAN Dentin sialophosphoprotein (Fragment) OS=... 37 0.39

>tr|B7SEW6|B7SEW6_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 766

Score = 42.7 bits (99), Expect = 0.009
Identities = 27/112 (24%), Positives = 49/112 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + D S + + D S S N +S+
Sbjct: 210 DSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSDSSDSSNSSDSS 269

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 270 DSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 36.2 bits (82), Expect = 0.88
Identities = 25/91 (27%), Positives = 39/91 (42%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ D +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDSSDSDSSNR 371



Score = 35.8 bits (81), Expect = 1.1
Identities = 23/96 (23%), Positives = 43/96 (44%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S S S+ S + +D + S D + + D S S + +S+ S
Sbjct: 611 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSS 670

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+++S S D++ D +S+D+N + ++S
Sbjct: 671 DSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 706



Score = 35.4 bits (80), Expect = 1.5
Identities = 26/106 (24%), Positives = 51/106 (48%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTA 178
SDS+++S S D++ D +S+ ++ + ++S N D++
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSSSSDSS-NSSDSS 209


>tr|B7SEX1|B7SEX1_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 763

Score = 40.0 bits (92), Expect = 0.061
Identities = 25/96 (26%), Positives = 49/96 (51%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S+S S+ S + +D + + D S+ + D + +S+ S D + +S+ S
Sbjct: 315 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSS--NSSDSSDSSDSSDSSDSDSSNRS 372

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+N+S S D++ D +S+D+N + ++S
Sbjct: 373 DSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSS 408



Score = 38.1 bits (87), Expect = 0.23
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 605 DSSDSSESSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 664

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 665 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 703



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 36.2 bits (82), Expect = 0.88
Identities = 25/91 (27%), Positives = 39/91 (42%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ D +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDSSDSDSSNR 371



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219


>tr|B7SEY4|B7SEY4_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 814

Score = 39.7 bits (91), Expect = 0.079
Identities = 25/96 (26%), Positives = 49/96 (51%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S+S S+ S + +D + + D S+ + D + +S+ S D + +S+ S
Sbjct: 315 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSS--NSSDSSDSSDSSDGSDSDSSNRS 372

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+N+S S D++ D +S+D+N + ++S
Sbjct: 373 DSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSS 408



Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 371



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 37.4 bits (85), Expect = 0.39
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 656 DSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 715

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 716 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 754



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219


>tr|B7SEX4|B7SEX4_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 820

Score = 39.7 bits (91), Expect = 0.079
Identities = 25/96 (26%), Positives = 49/96 (51%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S+S S+ S + +D + + D S+ + D + +S+ S D + +S+ S
Sbjct: 315 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSS--NSSDSSDSSDSSDGSDSDSSNRS 372

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+N+S S D++ D +S+D+N + ++S
Sbjct: 373 DSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSS 408



Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 371



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 36.2 bits (82), Expect = 0.88
Identities = 23/96 (23%), Positives = 44/96 (45%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S S S+ S + +D + S D ++ + D S S + +S+ S
Sbjct: 665 DSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 724

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+++S S D++ D +S+D+N + ++S
Sbjct: 725 DSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 760



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219


>tr|B7SEX2|B7SEX2_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 763

Score = 39.7 bits (91), Expect = 0.079
Identities = 25/96 (26%), Positives = 49/96 (51%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S+S S+ S + +D + + D S+ + D + +S+ S D + +S+ S
Sbjct: 315 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSS--NSSDSSDSSDSSDGSDSDSSNRS 372

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+N+S S D++ D +S+D+N + ++S
Sbjct: 373 DSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSS 408



Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 371



Score = 38.1 bits (87), Expect = 0.23
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 605 DSSDSSESSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 664

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 665 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 703



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219


>tr|B7SEZ0|B7SEZ0_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 390

Score = 38.9 bits (89), Expect = 0.14
Identities = 25/99 (25%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S E +D + S D + + D S S + +S+
Sbjct: 226 DSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSS 285

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 286 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 324


>tr|B7SEY5|B7SEY5_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 757

Score = 38.9 bits (89), Expect = 0.14
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDGSDSNSSNR 371



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 35.8 bits (81), Expect = 1.1
Identities = 25/99 (25%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S E +D + S D + + D S S + +S+
Sbjct: 596 DSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSS---DSSDSSDSS 652

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 653 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 691



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219



Score = 35.0 bits (79), Expect = 2.0
Identities = 23/97 (23%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDI-NMLGPDESTQSFFPRDDNREESAVC 310
D S+S S+ S + +D + + D S+ + D N +S+ S D N +
Sbjct: 315 DSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDGSDSNSSNRSDS 374

Query: 309 SDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
S+S+++S S +++ D +S+D+N + ++S
Sbjct: 375 SNSSDSSDSSDSSNSSDSSDSSDSSDSNESSNSSDSS 411


>tr|B7SEY2|B7SEY2_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 767

Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 280 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 338

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 339 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 369



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 202 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 260

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 261 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 319



Score = 37.0 bits (84), Expect = 0.52
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 603 DSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 662

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 663 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 701



Score = 33.9 bits (76), Expect = 4.4
Identities = 23/87 (26%), Positives = 41/87 (47%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 VCSDSANNSAGYQSCDATILQDGPEST 235
SDS+++S S D++ D +S+
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSS 191


>tr|B7SEY1|B7SEY1_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 772

Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 282 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 340

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 341 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 371



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 204 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 262

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 263 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 321



Score = 35.8 bits (81), Expect = 1.1
Identities = 23/96 (23%), Positives = 43/96 (44%)
Frame = -1

Query: 486 DQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESAVCS 307
D S S S+ S + +D + S D + + D S S + +S+ S
Sbjct: 617 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSS 676

Query: 306 DSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
DS+++S S D++ D +S+D+N + ++S
Sbjct: 677 DSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 712



Score = 35.0 bits (79), Expect = 2.0
Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 ---VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
SDS+N+S S D++ D S+D++ + ++S + + ++D
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSD 219


>tr|B7SEX9|B7SEX9_HUMAN Dentin sialophosphoprotein (Fragment)
OS=Homo sapiens GN=DSPP PE=4 SV=1
Length = 769

Score = 38.5 bits (88), Expect = 0.18
Identities = 26/91 (28%), Positives = 40/91 (43%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + D S D S + N +S+ S N +S+
Sbjct: 288 DSSDSSDSSDSSNSSDSNDSSNSSDSSD-SSNSSDSSNSSDSSDSSDSSDSDSSNSSDSS 346

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNR 223
SDS+++S S D++ DG +S +NR
Sbjct: 347 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNR 377



Score = 37.4 bits (85), Expect = 0.39
Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 7/119 (5%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDD------ 334
D D S+S S+ S + +D + S D ++ + D + +S+ S D
Sbjct: 210 DSSDSSNSSESSDSSDSSD-SDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDS 268

Query: 333 -NREESAVCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTAFQAAAD 160
N +S+ SDS+N+S S D++ D S+D+N + ++S + + ++D
Sbjct: 269 SNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSD 327



Score = 35.4 bits (80), Expect = 1.5
Identities = 26/106 (24%), Positives = 51/106 (48%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S+S S+ S + +D + S D KS ++ + +S D N +S+
Sbjct: 107 DSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSD--SSDSNSSDSS 164

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETSFNERDTA 178
SDS+++S S D++ D +S+ ++ + ++S N D++
Sbjct: 165 DNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSSSSDSS-NSSDSS 209



Score = 35.4 bits (80), Expect = 1.5
Identities = 24/99 (24%), Positives = 44/99 (44%)
Frame = -1

Query: 495 DGIDQSSSDRSNGSGECADLEEKSVHDDVKSTKAQDINMLGPDESTQSFFPRDDNREESA 316
D D S S S+ S + +D + S D + + D S S + +S+
Sbjct: 608 DSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSS---DSSDSSDSS 664

Query: 315 VCSDSANNSAGYQSCDATILQDGPESTDTNRVTICQETS 199
SDS+++S S D++ D +S+D+N + ++S
Sbjct: 665 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 703