BP915892
Clone id YMU001_000079_B08
Library
Length 588
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_B08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCCGCCAGTATGACAAGACTGTTGTTGTAAAACAAGATTACTCTTTGAAGACTAGAACG
AATCAAAACACCAGCAAACCATAGAGACTAAACCATGCACAACACAAAATCGTACATTCG
ACCTACAAGACAAATTGATTGTTCATTCACGACCACCAAGACAACCACTGCAAGACCTAC
AAGACATTGATTTGTACTTAATGACCTGCCAAATAAAAATTGTACAGTCGACTCATCGAA
ATGATTCTCGAATGCATTAACAACAAATCATGAGTGGAGATATAACCTTGCAAAACAGCA
CTGCACGGATTTGTACTTGATGACCTGCAACAGAACTGCGTTAACAACAGCATTATCCAG
CAAGTACATAAAATTGTACATTCAACTCATCAGAACAATTCTCGAATGCATTAACAACAA
AACATGAGTGAAGACAAATCTCGAAAGCATTAACAACAAAACATGAGCAAGTACTCTCCA
ATACAAATCAAGCCTCGACTCTCCAATACATAAAAGATAGTTGAGCTACTCGCTCTCAAA
ACTCTCGTCAGCAGAATCATTGTCTCCAAAAACCGCAACAGCATTTCT
■■Homology search results ■■ -
sp_hit_id Q28CE7
Definition sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis
Align length 35
Score (bit) 30.4
E-value 6.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915892|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_B08.
(588 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN... 30 6.9
sp|P53304|SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces c... 30 8.9

>sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis
GN=slc30a5 PE=2 SV=1
Length = 777

Score = 30.4 bits (67), Expect = 6.9
Identities = 11/35 (31%), Positives = 24/35 (68%)
Frame = -1

Query: 108 FVLCMV*SLWFAGVLIRSSLQRVILFYNNSLVILA 4
FV C++ LWF G+ + L+ ++LF ++ +V+++
Sbjct: 96 FVSCIISLLWFFGLTLCGPLRTLLLFEHSDIVVIS 130


>sp|P53304|SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces
cerevisiae GN=SLI1 PE=4 SV=1
Length = 468

Score = 30.0 bits (66), Expect = 8.9
Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%)
Frame = +2

Query: 263 TNHEWRYNLAKQHCTDLYLMTC--NRTALTTALSS 361
TNH+W + L+ H D+ L C N T+LT+ L +
Sbjct: 242 TNHQWEFRLSPTHLNDI-LQECKANNTSLTSLLGA 275


tr_hit_id A8YH86|A8YH86_MICAE Similar to tr|Q8YVI7
Definition tr|A8YH86|A8YH86_MICAE Similar to tr|Q8YVI7|Q8YVI7 OS=Microcystis aeruginosa PCC 7806
Align length 55
Score (bit) 33.5
E-value 9.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915892|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_B08.
(588 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8YH86|A8YH86_MICAE Similar to tr|Q8YVI7|Q8YVI7 OS=Microcysti... 33 9.1

>tr|A8YH86|A8YH86_MICAE Similar to tr|Q8YVI7|Q8YVI7 OS=Microcystis
aeruginosa PCC 7806 GN=IPF_1950 PE=4 SV=1
Length = 264

Score = 33.5 bits (75), Expect = 9.1
Identities = 19/55 (34%), Positives = 28/55 (50%)
Frame = +3

Query: 93 PCTTQNRTFDLQDKLIVHSRPPRQPLQDLQDIDLYLMTCQIKIVQSTHRNDSRMH 257
P + TF+ KL H R R + L+D+D YL+ Q +V HR D ++H
Sbjct: 184 PRNPEQITFNYNQKL--HQRTGRDLRRLLKDLDRYLLAYQNDLVDFPHRPDCQLH 236