BP915901
Clone id YMU001_000079_C06
Library
Length 534
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000079_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGGATGCAGTCTTTGATTGCAAGAGTGAGGTTATCGGACCTCGAGCATATAGGTTCAAA
GCAGAAATAGATTTTAATGGGGTTGTGATTGTCCAAAATTATCTGAAGGGGGTCAACAGA
GAGACATGGGCAGATCAGGTGATCTTGTGAATTTGCTTACTTTTCAAGAGCATACCTGCT
CTTAGGAAGGTGTTGTTTAACTTTCCTGGACTTTTCATACGTGTGACCTTGTCAATGCAG
TTTAGAGATGCTTTAAATGATCCTGATGGTCGTGCATTGGACCGTGTCATGTCTGACTAT
GGTGAGGAAGTAGTGACCGCTCTCGGCAGTGAAGTAGACAGATTAGAAAGAGAGATCCAG
AGACTGGTACCAGGAATTCGACATGTAGATATTGAAACCCACAATCCAAATGGACCTTTT
CCTTTCTGATTTGCATTAAACCTGCCTCAGGCTCGAGCCAAAGATCTAGAGAAGTGAATG
CCATCTCACCAAACTATTGTCATTGGAAGGAAAGGAATGTGCAGCTGTTAAGTT
■■Homology search results ■■ -
sp_hit_id Q8H1G3
Definition sp|Q8H1G3|MTPC4_ARATH Metal tolerance protein C4 OS=Arabidopsis thaliana
Align length 141
Score (bit) 134.0
E-value 3.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915901|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_C06.
(534 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H1G3|MTPC4_ARATH Metal tolerance protein C4 OS=Arabidopsis ... 134 3e-31
sp|Q5IRJ6|ZNT9_MOUSE Zinc transporter 9 OS=Mus musculus GN=Slc30... 58 3e-08
sp|Q5PQZ3|ZNT9_DANRE Zinc transporter 9 OS=Danio rerio GN=slc30a... 58 3e-08
sp|Q5R4H0|ZNT9_PONAB Zinc transporter 9 OS=Pongo abelii GN=SLC30... 57 6e-08
sp|Q6PML9|ZNT9_HUMAN Zinc transporter 9 OS=Homo sapiens GN=SLC30... 57 6e-08
sp|Q6DCE3|ZNT9_XENLA Zinc transporter 9 OS=Xenopus laevis GN=slc... 57 7e-08
sp|P70567|TMOD1_RAT Tropomodulin-1 OS=Rattus norvegicus GN=Tmod1... 32 1.5
sp|P49813|TMOD1_MOUSE Tropomodulin-1 OS=Mus musculus GN=Tmod1 PE... 32 1.5
sp|P28289|TMOD1_HUMAN Tropomodulin-1 OS=Homo sapiens GN=TMOD1 PE... 32 1.5
sp|A0JNC0|TMOD1_BOVIN Tropomodulin-1 OS=Bos taurus GN=TMOD1 PE=2... 32 1.5
sp|P55517|Y4JQ_RHISN Uncharacterized protein y4jQ OS=Rhizobium s... 30 5.7
sp|A5EES7|MTND_BRASB Acireductone dioxygenase OS=Bradyrhizobium ... 30 5.7
sp|Q03018|ESP1_YEAST Separin OS=Saccharomyces cerevisiae GN=ESP1... 30 5.7
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myx... 30 7.4
sp|Q2QDF0|DNSL1_PIG Deoxyribonuclease-1-like 1 OS=Sus scrofa GN=... 30 9.7

>sp|Q8H1G3|MTPC4_ARATH Metal tolerance protein C4 OS=Arabidopsis
thaliana GN=MTPC4 PE=2 SV=1
Length = 457

Score = 134 bits (337), Expect = 3e-31
Identities = 72/141 (51%), Positives = 86/141 (60%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VD+++DCKSEVIGP ++RFKAEIDFNG ++VQNYLK RE WA
Sbjct: 349 VDSLYDCKSEVIGPGSFRFKAEIDFNGQMVVQNYLKRTGREEWAKM-------------- 394

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
FR+A + D A+ +MS+YGEEVVTALGSEVDRLE+EIQ
Sbjct: 395 --------------------FREAAKNGDDSAMLNIMSNYGEEVVTALGSEVDRLEKEIQ 434

Query: 361 RLVPGIRHVDIETHNPNGPFP 423
LVPGI+HVDIE HNP P
Sbjct: 435 ELVPGIQHVDIEAHNPTPTDP 455


>sp|Q5IRJ6|ZNT9_MOUSE Zinc transporter 9 OS=Mus musculus GN=Slc30a9
PE=1 SV=2
Length = 567

Score = 57.8 bits (138), Expect = 3e-08
Identities = 40/132 (30%), Positives = 64/132 (48%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + DQ+
Sbjct: 471 VRAIHDVKATDLGLGKVRFKAEVDFDGRVVTRSYLEKQD----FDQM------------- 513

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
MQ + P+ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 514 ------------------MQEIQEVKTPE--QLEAFMLKHGENIIDTLGAEVDRLEKELK 553

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 554 KRNPEVRHVDLE 565


>sp|Q5PQZ3|ZNT9_DANRE Zinc transporter 9 OS=Danio rerio GN=slc30a9
PE=2 SV=1
Length = 573

Score = 57.8 bits (138), Expect = 3e-08
Identities = 37/132 (28%), Positives = 63/132 (47%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + E +++
Sbjct: 477 VRAIHDVKATDMGLSKVRFKAEVDFDGRVVTRSYLEKQDIEQILNEI------------- 523

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+ P+ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 524 ----------------------QQVKTPE--ELENFMLKHGENIIDTLGAEVDRLEKELK 559

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 560 QRNPEVRHVDLE 571


>sp|Q5R4H0|ZNT9_PONAB Zinc transporter 9 OS=Pongo abelii GN=SLC30A9
PE=2 SV=1
Length = 569

Score = 57.0 bits (136), Expect = 6e-08
Identities = 36/132 (27%), Positives = 62/132 (46%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + + ++
Sbjct: 473 VRAIHDVKATDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEI------------- 519

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+ P+ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 520 ----------------------QEVKTPE--ELETFMLKHGENIIDTLGAEVDRLEKELK 555

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 556 KRNPEVRHVDLE 567


>sp|Q6PML9|ZNT9_HUMAN Zinc transporter 9 OS=Homo sapiens GN=SLC30A9
PE=2 SV=1
Length = 568

Score = 57.0 bits (136), Expect = 6e-08
Identities = 36/132 (27%), Positives = 62/132 (46%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + + ++
Sbjct: 472 VRAIHDVKATDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEI------------- 518

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+ P+ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 519 ----------------------QEVKTPE--ELETFMLKHGENIIDTLGAEVDRLEKELK 554

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 555 KRNPEVRHVDLE 566


>sp|Q6DCE3|ZNT9_XENLA Zinc transporter 9 OS=Xenopus laevis
GN=slc30a9 PE=2 SV=1
Length = 559

Score = 56.6 bits (135), Expect = 7e-08
Identities = 38/132 (28%), Positives = 62/132 (46%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + I L+ I
Sbjct: 463 VRAIHDVKATDMGMSKVRFKAEVDFDGRVVTRSYLEKQD-----------IDLVLNEIRQ 511

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
++ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 512 VKTA--------------------------EDLEAFMLKHGENIIDTLGAEVDRLEKELK 545

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 546 QRNPEVRHVDLE 557


>sp|P70567|TMOD1_RAT Tropomodulin-1 OS=Rattus norvegicus GN=Tmod1
PE=2 SV=1
Length = 359

Score = 32.3 bits (72), Expect = 1.5
Identities = 19/64 (29%), Positives = 32/64 (50%)
Frame = +1

Query: 280 DRVMSDYGEEVVTALGSEVDRLEREIQRLVPGIRHVDIETHNPNGPFPF*FALNLPQARA 459
D ++ EE + L +E+D L+ + L G+R D T P GPF L+ + +A
Sbjct: 16 DEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQA 75

Query: 460 KDLE 471
K+ +
Sbjct: 76 KEFK 79


>sp|P49813|TMOD1_MOUSE Tropomodulin-1 OS=Mus musculus GN=Tmod1 PE=2
SV=1
Length = 359

Score = 32.3 bits (72), Expect = 1.5
Identities = 19/64 (29%), Positives = 32/64 (50%)
Frame = +1

Query: 280 DRVMSDYGEEVVTALGSEVDRLEREIQRLVPGIRHVDIETHNPNGPFPF*FALNLPQARA 459
D ++ EE + L +E+D L+ + L G+R D T P GPF L+ + +A
Sbjct: 16 DEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQA 75

Query: 460 KDLE 471
K+ +
Sbjct: 76 KEFK 79


>sp|P28289|TMOD1_HUMAN Tropomodulin-1 OS=Homo sapiens GN=TMOD1 PE=1
SV=1
Length = 359

Score = 32.3 bits (72), Expect = 1.5
Identities = 19/64 (29%), Positives = 32/64 (50%)
Frame = +1

Query: 280 DRVMSDYGEEVVTALGSEVDRLEREIQRLVPGIRHVDIETHNPNGPFPF*FALNLPQARA 459
D ++ EE + L +E+D L+ + L G+R D T P GPF L+ + +A
Sbjct: 16 DEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQA 75

Query: 460 KDLE 471
K+ +
Sbjct: 76 KEFK 79


>sp|A0JNC0|TMOD1_BOVIN Tropomodulin-1 OS=Bos taurus GN=TMOD1 PE=2
SV=1
Length = 359

Score = 32.3 bits (72), Expect = 1.5
Identities = 16/47 (34%), Positives = 24/47 (51%)
Frame = +1

Query: 280 DRVMSDYGEEVVTALGSEVDRLEREIQRLVPGIRHVDIETHNPNGPF 420
D ++ EE + L +E+D L+ + L G+R D T P GPF
Sbjct: 16 DEILGGLTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPF 62


tr_hit_id A7Q458
Definition tr|A7Q458|A7Q458_VITVI Chromosome chr9 scaffold_49, whole genome shotgun sequence OS=Vitis vinifera
Align length 141
Score (bit) 152.0
E-value 8.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915901|Adiantum capillus-veneris mRNA, clone:
YMU001_000079_C06.
(534 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q458|A7Q458_VITVI Chromosome chr9 scaffold_49, whole genome... 152 8e-36
tr|A9T1R0|A9T1R0_PHYPA Predicted protein OS=Physcomitrella paten... 149 1e-34
tr|B4FWX3|B4FWX3_MAIZE Putative uncharacterized protein OS=Zea m... 131 3e-29
tr|Q7XVV0|Q7XVV0_ORYSA OSJNBa0035B13.1 protein OS=Oryza sativa G... 130 4e-29
tr|Q0JEC1|Q0JEC1_ORYSJ Os04g0298200 protein OS=Oryza sativa subs... 130 4e-29
tr|B8AS09|B8AS09_ORYSI Putative uncharacterized protein OS=Oryza... 130 4e-29
tr|A4RQQ8|A4RQQ8_OSTLU CDF family transporter: cation efflux OS=... 81 3e-14
tr|Q01GU4|Q01GU4_OSTTA Membrane protein HUEL (Cation efflux supe... 75 3e-12
tr|A8J2F6|A8J2F6_CHLRE CDF transporter, membrane protein (Fragme... 66 1e-09
tr|Q7SZY7|Q7SZY7_DANRE Novel protein similar to human chromosome... 58 4e-07
tr|B2RU82|B2RU82_MOUSE Solute carrier family 30 (Zinc transporte... 58 4e-07
tr|B5U335|B5U335_PIG Solute carrier family 30 member 9 OS=Sus sc... 57 6e-07
tr|B4DSU2|B4DSU2_HUMAN cDNA FLJ50854, highly similar to Homo sap... 57 6e-07
tr|B6MIV8|B6MIV8_BRAFL Putative uncharacterized protein OS=Branc... 55 2e-06
tr|B2R745|B2R745_HUMAN cDNA, FLJ93277, highly similar to Homo sa... 55 2e-06
tr|Q4RTG8|Q4RTG8_TETNG Chromosome 1 SCAF14998, whole genome shot... 55 3e-06
tr|B4JVC1|B4JVC1_DROGR GH22699 OS=Drosophila grimshawi GN=GH2269... 54 4e-06
tr|A7S785|A7S785_NEMVE Predicted protein OS=Nematostella vectens... 54 5e-06
tr|A8X9R9|A8X9R9_CAEBR Putative uncharacterized protein OS=Caeno... 53 1e-05
tr|B7QBP7|B7QBP7_IXOSC Zinc transporter, putative OS=Ixodes scap... 51 4e-05
tr|B4QDF0|B4QDF0_DROSI GD10910 OS=Drosophila simulans GN=GD10910... 51 4e-05
tr|B4HPM6|B4HPM6_DROSE GM21415 OS=Drosophila sechellia GN=GM2141... 51 4e-05
tr|B3RX82|B3RX82_TRIAD Putative uncharacterized protein OS=Trich... 51 4e-05
tr|B3MCU6|B3MCU6_DROAN GF13401 OS=Drosophila ananassae GN=GF1340... 51 4e-05
tr|B4P505|B4P505_DROYA GE12486 OS=Drosophila yakuba GN=GE12486 P... 50 6e-05
tr|B3NRX1|B3NRX1_DROER GG20327 OS=Drosophila erecta GN=GG20327 P... 50 6e-05
tr|A1Z936|A1Z936_DROME CG8632, isoform A OS=Drosophila melanogas... 50 6e-05
tr|A1Z935|A1Z935_DROME CG8632, isoform B OS=Drosophila melanogas... 50 6e-05
tr|B4LP84|B4LP84_DROVI GJ21348 OS=Drosophila virilis GN=GJ21348 ... 50 1e-04
tr|B4KSP8|B4KSP8_DROMO GI18486 OS=Drosophila mojavensis GN=GI184... 50 1e-04

>tr|A7Q458|A7Q458_VITVI Chromosome chr9 scaffold_49, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029545001
PE=4 SV=1
Length = 459

Score = 152 bits (385), Expect = 8e-36
Identities = 82/141 (58%), Positives = 91/141 (64%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VDA++DCKSEVIGP +RFKAEIDFNGVV+VQNYLK RETWA
Sbjct: 353 VDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLKRTGRETWA---------------- 396

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
QFR+A + D AL R+MS+YGEEVVTALGSEVDRLE+EIQ
Sbjct: 397 ------------------RQFREAAKEEDDSALLRMMSNYGEEVVTALGSEVDRLEKEIQ 438

Query: 361 RLVPGIRHVDIETHNPNGPFP 423
LVPGIRHVDIE HNP GP P
Sbjct: 439 ELVPGIRHVDIEAHNPTGPSP 459


>tr|A9T1R0|A9T1R0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_138991 PE=4 SV=1
Length = 359

Score = 149 bits (375), Expect = 1e-34
Identities = 76/141 (53%), Positives = 92/141 (65%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V+ ++DCKSEVIGP YRFKAEIDFNGVVIVQNYL+ V R+ W +
Sbjct: 246 VEGLYDCKSEVIGPGEYRFKAEIDFNGVVIVQNYLQRVGRDNWME--------------- 290

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+FR A+ + DG LDRVM++YGEEVV+A+G EVDRLE++IQ
Sbjct: 291 -------------------EFRKAVRNSDGSVLDRVMAEYGEEVVSAVGCEVDRLEKDIQ 331

Query: 361 RLVPGIRHVDIETHNPNGPFP 423
+LVPGIRHVDIE HNPNGP P
Sbjct: 332 KLVPGIRHVDIEAHNPNGPTP 352


>tr|B4FWX3|B4FWX3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 125

Score = 131 bits (329), Expect = 3e-29
Identities = 72/138 (52%), Positives = 84/138 (60%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VDA++DCKSEVIGP +RFKAEIDFNGVV+VQNYL+ R +WA Q
Sbjct: 14 VDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGSWAKQ-------------- 59

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
FR+A D L RVM++YGE+VV ALG EVDRLE EIQ
Sbjct: 60 --------------------FREAAMSKDDTELLRVMANYGEDVVEALGYEVDRLESEIQ 99

Query: 361 RLVPGIRHVDIETHNPNG 414
+LVPGI+HVDIE HNP G
Sbjct: 100 KLVPGIKHVDIEAHNPEG 117


>tr|Q7XVV0|Q7XVV0_ORYSA OSJNBa0035B13.1 protein OS=Oryza sativa
GN=OSJNBa0035B13.1 PE=4 SV=3
Length = 334

Score = 130 bits (327), Expect = 4e-29
Identities = 72/138 (52%), Positives = 83/138 (60%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VDA++DCKSEVIGP +RFKAEIDFNGVV+VQNYL+ R WA Q
Sbjct: 228 VDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ-------------- 273

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
FR+A D L RVMS+YGE+VV ALG EVDRLE EIQ
Sbjct: 274 --------------------FREASLSKDDTELIRVMSNYGEDVVEALGYEVDRLESEIQ 313

Query: 361 RLVPGIRHVDIETHNPNG 414
++VPGI+HVDIE HNP G
Sbjct: 314 KIVPGIKHVDIEAHNPEG 331


>tr|Q0JEC1|Q0JEC1_ORYSJ Os04g0298200 protein OS=Oryza sativa subsp.
japonica GN=Os04g0298200 PE=4 SV=1
Length = 334

Score = 130 bits (327), Expect = 4e-29
Identities = 72/138 (52%), Positives = 83/138 (60%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VDA++DCKSEVIGP +RFKAEIDFNGVV+VQNYL+ R WA Q
Sbjct: 228 VDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ-------------- 273

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
FR+A D L RVMS+YGE+VV ALG EVDRLE EIQ
Sbjct: 274 --------------------FREASLSKDDTELIRVMSNYGEDVVEALGYEVDRLESEIQ 313

Query: 361 RLVPGIRHVDIETHNPNG 414
++VPGI+HVDIE HNP G
Sbjct: 314 KIVPGIKHVDIEAHNPEG 331


>tr|B8AS09|B8AS09_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15280 PE=4 SV=1
Length = 472

Score = 130 bits (327), Expect = 4e-29
Identities = 72/138 (52%), Positives = 83/138 (60%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
VDA++DCKSEVIGP +RFKAEIDFNGVV+VQNYL+ R WA Q
Sbjct: 366 VDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ-------------- 411

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
FR+A D L RVMS+YGE+VV ALG EVDRLE EIQ
Sbjct: 412 --------------------FREASLSEDDTELIRVMSNYGEDVVEALGYEVDRLESEIQ 451

Query: 361 RLVPGIRHVDIETHNPNG 414
++VPGI+HVDIE HNP G
Sbjct: 452 KIVPGIKHVDIEAHNPEG 469


>tr|A4RQQ8|A4RQQ8_OSTLU CDF family transporter: cation efflux
OS=Ostreococcus lucimarinus (strain CCE9901)
GN=OSTLU_39741 PE=4 SV=1
Length = 345

Score = 81.3 bits (199), Expect = 3e-14
Identities = 48/134 (35%), Positives = 69/134 (51%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V+ V+ KSE +G YRF AE++F+G IV+ YL NR
Sbjct: 245 VEEVYFAKSEELGAGTYRFAAEVEFSGKKIVERYLAKKNR-------------------- 284

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
R+ L +F +A D +A+D +S YGEE+V A+G EVDR+E+EI
Sbjct: 285 -------------RMELHSKFNEASISADAQAMDGALSFYGEEIVQAVGDEVDRMEKEIV 331

Query: 361 RLVPGIRHVDIETH 402
++ P I +VDIET+
Sbjct: 332 KIEPSIHYVDIETN 345


>tr|Q01GU4|Q01GU4_OSTTA Membrane protein HUEL (Cation efflux
superfamily) (ISS) OS=Ostreococcus tauri GN=Ot01g01390
PE=4 SV=1
Length = 481

Score = 74.7 bits (182), Expect = 3e-12
Identities = 49/134 (36%), Positives = 67/134 (50%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V+ V+ KSE +G AYRF E++F+G IV+ YL R
Sbjct: 384 VEEVYFAKSEELGAGAYRFAVEVEFSGKKIVERYLAKHQR-------------------- 423

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
R+ L +F A NDP +ALD + YGE++V A+G EVDRLE+EI
Sbjct: 424 -------------RMALHSKF-SAANDP--KALDAALVQYGEDIVQAVGDEVDRLEKEIV 467

Query: 361 RLVPGIRHVDIETH 402
+ P I +VDIET+
Sbjct: 468 EIEPSIHYVDIETN 481


>tr|A8J2F6|A8J2F6_CHLRE CDF transporter, membrane protein (Fragment)
OS=Chlamydomonas reinhardtii GN=MTP5 PE=4 SV=1
Length = 472

Score = 66.2 bits (160), Expect = 1e-09
Identities = 45/133 (33%), Positives = 65/133 (48%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V V D K+E IG YRFKAE+ ++G +V YL R+ +
Sbjct: 302 VQYVTDTKTEEIGAGMYRFKAEVAWDGDQVVGRYLDRCGRDQLLGR-------------- 347

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+Q A ND AL+ ++ YG E+++A+G+EVDR+E EIQ
Sbjct: 348 ------------------LQAAAAANDR--AALEALVQSYGRELISAVGAEVDRIEGEIQ 387

Query: 361 RLVPGIRHVDIET 399
+L PGI +VD+ET
Sbjct: 388 KLNPGILYVDLET 400


>tr|Q7SZY7|Q7SZY7_DANRE Novel protein similar to human chromosome 4
open reading frame 1 (C4orf1) OS=Danio rerio GN=slc30a9
PE=2 SV=1
Length = 336

Score = 57.8 bits (138), Expect = 4e-07
Identities = 37/132 (28%), Positives = 63/132 (47%)
Frame = +1

Query: 1 VDAVFDCKSEVIGPRAYRFKAEIDFNGVVIVQNYLKGVNRETWADQVIL*ICLLFKSIPA 180
V A+ D K+ +G RFKAE+DF+G V+ ++YL+ + E +++
Sbjct: 240 VRAIHDVKATDMGLSKVRFKAEVDFDGRVVTRSYLEKQDIEQILNEI------------- 286

Query: 181 LRKVLFNFPGLFIRVTLSMQFRDALNDPDGRALDRVMSDYGEEVVTALGSEVDRLEREIQ 360
+ P+ L+ M +GE ++ LG+EVDRLE+E++
Sbjct: 287 ----------------------QQVKTPE--ELENFMLKHGENIIDTLGAEVDRLEKELK 322

Query: 361 RLVPGIRHVDIE 396
+ P +RHVD+E
Sbjct: 323 QRNPEVRHVDLE 334